Phrixotoxin-3, Voltage-gated Na+ channel blocker (ab141845)

Overview

  • Product name

    Phrixotoxin-3, Voltage-gated Na+ channel blocker
  • Description

    Voltage-gated Na+ channel blocker
  • Purity

    > 99%
  • Chemical structure

    Chemical Structure

Properties

  • Molecular weight

    4060.00
  • Molecular formula

    C176H269N51O48S6
  • Sequence

    DCLGFLWKCNPSNDKCCRPNLVCSRKDKWCKYQI (Modifications: Disulfide bonds: 2-17, 9-23, 16-30)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Any aqueous buffer. Centrifuge all product preparations before use (10000 x g 5 min).
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one month. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Synthetic

  • Research areas

Images

  • Phrixotoxin-3 inhibits NaV1.2 channels heterologously expressed in Xenopus oocytes.

    Superimposed traces of NaV1.2 currents before (green) and during (black) application of 300 nM Phrixotoxin-3 (ab141845). Currents were elicited from a holding potential of -100 mV and test pulses of 35 ms to +60 mV were delivered every 5 sec.

References

ab141845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
For licensing inquiries, please contact partnerships@abcam.com

Sign up