Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307)

Overview

  • Product name

    Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10]
    See all PI 3 Kinase catalytic subunit gamma/PI3K-gamma primary antibodies
  • Description

    Mouse monoclonal [OTI4G10] to PI 3 Kinase catalytic subunit gamma/PI3K-gamma
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human PI 3 Kinase catalytic subunit gamma/PI3K-gamma aa 1-1102. Produced in HEK-293T cells (NP_002640).
    Sequence:

    MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRK CKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY QKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAF QRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHP WVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFT KMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVF TVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTS PKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESP SSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNAD KLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQ LRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLES LEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLR SEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIK SLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEK CKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRI MESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHND NIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGK KTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEY IRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKH SA


    Database link: P48736

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRYPI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA. IHC-P: Human ovary adenocarcinoma and pancreas tissues. ICC/IF: COS-7 cells transiently transfected by pCMV6-ENTRY PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA.
  • General notes

    Clone OTI4G10 (formerly 4G10).

    Previously labelled as PI 3 Kinase catalytic subunit gamma. 

Properties

Applications

Our Abpromise guarantee covers the use of ab140307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 126 kDa.
IHC-P 1/150. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/100.

Target

  • Function

    3-phosphorylates the cellular phosphoinositide PtdIns-4,5-biphosphate (PtdIns(4,5)P2) to produce PtdIns-3, 4,5-triiphosphate (PtdIns(3,4,5)P3). Links G-protein coupled receptor activation to the secondary messenger PtdIns(3,4,5)P3 production.
  • Tissue specificity

    Pancreas, skeletal muscle, liver and heart.
  • Pathway

    Phospholipid metabolism; phosphatidylinositol phosphate biosynthesis.
  • Sequence similarities

    Belongs to the PI3/PI4-kinase family.
    Contains 1 PI3K/PI4K domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1 phosphatidylinositol 3 kinase antibody
    • 5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma antibody
    • 5-bisphosphate 3-kinase catalytic subunit gamma isoform antibody
    • p110 gamma antibody
    • p110gamma antibody
    • p120 PI3K antibody
    • p120-PI3K antibody
    • Phosphatidylinositol 3 kinase catalytic 110 kD gamma antibody
    • Phosphatidylinositol 3 kinase gamma, p110 gamma antibody
    • Phosphatidylinositol 3 kinase, catalytic, gamma polypeptide antibody
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit gamma antibody
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit gamma antibody
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit gamma isoform antibody
    • Phosphatidylinositol-4 antibody
    • Phosphoinositide 3 kinase catalytic gamma polypeptide antibody
    • Phosphoinositide 3 kinase gamma catalytic subunit antibody
    • PI 3 Kinase catalytic subunit gamma antibody
    • PI3 kinase p110 subunit gamma antibody
    • PI3-kinase subunit gamma antibody
    • PI3CG antibody
    • PI3K antibody
    • PI3K-gamma antibody
    • PI3Kgamma antibody
    • PIK3 antibody
    • Pik3cg antibody
    • PK3CG_HUMAN antibody
    • PtdIns-3-kinase subunit gamma antibody
    • PtdIns-3-kinase subunit p110-gamma antibody
    • Serine/threonine protein kinase PIK3CG antibody
    see all

Images

  • All lanes : Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4G10] (ab140307) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 126 kDa

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA, labelling PI 3 Kinase catalytic subunit gamma/PI3K-gamma (green) with ab140307 at 1/100 dilution in ICC/IF.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for PI 3 Kinase catalytic subunit gamma/PI3K-gamma using ab140307 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for PI 3 Kinase catalytic subunit gamma/PI3K-gamma using ab140307 at 1/150 dilution in immunohistochemical analysis.

References

ab140307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up