For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    pi-3-kinase-catalytic-subunit-gammapi3k-gamma-antibody-oti4h9-ab139307.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Signaling Pathway Lipid Signaling Lipid Kinases
Share by email

Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4H9] (ab139307)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4H9] (ab139307)

    Key features and details

    • Mouse monoclonal [OTI4H9] to PI 3 Kinase catalytic subunit gamma/PI3K-gamma
    • Suitable for: WB
    • Reacts with: Human
    • Isotype: IgG1

    You may also be interested in

    Protein
    Product image
    Recombinant human PI3K (p110 delta/p85 alpha) protein (Active) (ab125633)
    Protein
    Recombinant human PI 3 Kinase catalytic subunit gamma/PI3K-gamma protein (ab157600)
    Primary
    Product image
    Anti-PI 3 Kinase p85 alpha antibody [EPR18702] (ab191606)

    View more associated products

    Overview

    • Product name

      Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4H9]
      See all PI 3 Kinase catalytic subunit gamma/PI3K-gamma primary antibodies
    • Description

      Mouse monoclonal [OTI4H9] to PI 3 Kinase catalytic subunit gamma/PI3K-gamma
    • Host species

      Mouse
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Pig
    • Immunogen

      Recombinant full length protein corresponding to Human PI 3 Kinase catalytic subunit gamma/PI3K-gamma aa 1-1102. Produced in HEK293T cells (NP_002640).
      Sequence:

      MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPIEFVLPTSQRK CKSPETALLHVAGHGNVEQMKAQVWLRALETSVAADFYHRLGPHHFLLLY QKKGQWYEIYDKYQVVQTLDCLRYWKATHRSPGQIHLVQRHPPSEESQAF QRQLTALIGYDVTDVSNVHDDELEFTRRGLVTPRMAEVASRDPKLYAMHP WVTSKPLPEYLWKKIANNCIFIVIHRSTTSQTIKVSPDDTPGAILQSFFT KMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIKNFQWVRHCLKNG EEIHVVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVF TVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTS PKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESP SSESKGKVQLLYYVNLLLIDHRFLLRRGEYVLHMWQISGKGEDQGSFNAD KLTSATNPDKENSMSISILLDNYCHPIALPKHQPTPDPEGDRVRAEMPNQ LRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ QEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLES LEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLR SEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTQQVQVIEMLQKVTLDIK SLSAEKYDVSSQVISQLKQKLENLQNSQLPESFRVPYDPGLKAGALAIEK CKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRI MESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG AFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHND NIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGK KTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEY IRDALTVGKNEEDAKKYFLDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKH SA


      Database link: P48736
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • WB: HEK-293T cell lysate transfected with PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA.
    • General notes

      Clone OTI4H9 (formerly 4H9).

      Previously labelled as PI 3 Kinase catalytic subunit gamma. 

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.30
      Preservative: 0.02% Sodium azide
      Constituents: PBS, 50% Glycerol, 1% BSA
    • Concentration information loading...
    • Purity

      Affinity purified
    • Purification notes

      Purified from cell culture supernatant by affinity chromatography.
    • Clonality

      Monoclonal
    • Clone number

      OTI4H9
    • Isotype

      IgG1
    • Research areas

      • Signal Transduction
      • Signaling Pathway
      • Lipid Signaling
      • Lipid Kinases
      • Signal Transduction
      • Signaling Pathway
      • G Protein Signaling
      • GPCR
      • Cancer
      • Signal transduction
      • G protein signaling
      • GPCR
      • Immunology
      • Innate Immunity
      • TLR Signaling

    Associated products

    • Compatible Secondaries

      • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
      • Goat Anti-Mouse IgG H&L (HRP) (ab205719)
    • Isotype control

      • Mouse IgG1, kappa monoclonal [15-6E10A7] - Isotype Control (ab170190)
    • Recombinant Protein

      • Recombinant human PI 3 Kinase catalytic subunit gamma/PI3K-gamma protein (ab157600)
    • Related Products

      • Recombinant human PI 3 Kinase catalytic subunit gamma/PI3K-gamma protein (ab157600)

    Applications

    Our Abpromise guarantee covers the use of ab139307 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/1000. Predicted molecular weight: 126 kDa.

    Target

    • Function

      3-phosphorylates the cellular phosphoinositide PtdIns-4,5-biphosphate (PtdIns(4,5)P2) to produce PtdIns-3, 4,5-triiphosphate (PtdIns(3,4,5)P3). Links G-protein coupled receptor activation to the secondary messenger PtdIns(3,4,5)P3 production.
    • Tissue specificity

      Pancreas, skeletal muscle, liver and heart.
    • Pathway

      Phospholipid metabolism; phosphatidylinositol phosphate biosynthesis.
    • Sequence similarities

      Belongs to the PI3/PI4-kinase family.
      Contains 1 PI3K/PI4K domain.
    • Target information above from: UniProt accession P48736 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 5294 Human
      • Entrez Gene: 30955 Mouse
      • Entrez Gene: 396979 Pig
      • GenBank: AF327656 Human
      • Omim: 601232 Human
      • SwissProt: P48736 Human
      • SwissProt: Q9JHG7 Mouse
      • SwissProt: O02697 Pig
      • Unigene: 32942 Human
      • Unigene: 101369 Mouse
      • Unigene: 404021 Mouse
      see all
    • Alternative names

      • 1 phosphatidylinositol 3 kinase antibody
      • 5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma antibody
      • 5-bisphosphate 3-kinase catalytic subunit gamma isoform antibody
      • p110 gamma antibody
      • p110gamma antibody
      • p120 PI3K antibody
      • p120-PI3K antibody
      • Phosphatidylinositol 3 kinase catalytic 110 kD gamma antibody
      • Phosphatidylinositol 3 kinase gamma, p110 gamma antibody
      • Phosphatidylinositol 3 kinase, catalytic, gamma polypeptide antibody
      • Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit gamma antibody
      • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit gamma antibody
      • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit gamma isoform antibody
      • Phosphatidylinositol-4 antibody
      • Phosphoinositide 3 kinase catalytic gamma polypeptide antibody
      • Phosphoinositide 3 kinase gamma catalytic subunit antibody
      • PI 3 Kinase catalytic subunit gamma antibody
      • PI3 kinase p110 subunit gamma antibody
      • PI3-kinase subunit gamma antibody
      • PI3CG antibody
      • PI3K antibody
      • PI3K-gamma antibody
      • PI3Kgamma antibody
      • PIK3 antibody
      • Pik3cg antibody
      • PK3CG_HUMAN antibody
      • PtdIns-3-kinase subunit gamma antibody
      • PtdIns-3-kinase subunit p110-gamma antibody
      • Serine/threonine protein kinase PIK3CG antibody
      see all

    Images

    • Western blot - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4H9] (ab139307)
      Western blot - Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4H9] (ab139307)
      All lanes : Anti-PI 3 Kinase catalytic subunit gamma/PI3K-gamma antibody [OTI4H9] (ab139307) at 1/1000 dilution

      Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
      Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY PI 3 Kinase catalytic subunit gamma/PI3K-gamma cDNA

      Lysates/proteins at 5 µg per lane.

      Predicted band size: 126 kDa

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab139307? Please let us know so that we can cite the reference in this datasheet.

    ab139307 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab139307.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.