Overview

  • Product name

  • Description

    Rabbit polyclonal to PI-9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human PI-9 aa 1-376. (Expressed in E.coli).
    Sequence:

    METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNT ATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQF LSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPG SSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQ EATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEK LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL SAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC ADHPFLFFIRHNRANSILFCGRFSSP


    Database link: P50453

  • Positive control

    • IHC-P: Human stomach, cerebrum, prostate cancer, kidney, prostate and bile duct cancer tissues. WB: Recombinant human PI-9 protein; Human serum; Mouse placenta lysate; K562 cell lysate. ICC/IF: HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab233443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 42 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Granzyme B inhibitor.
  • Sequence similarities

    Belongs to the serpin family. Ov-serpin subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Alternative names

    • CAP 3 antibody
    • CAP-3 antibody
    • CAP3 antibody
    • Cytoplasmic antiproteinase 3 antibody
    • Peptidase inhibitor 9 antibody
    • PI-9 antibody
    • PI9 antibody
    • Protease inhibitor 9 antibody
    • Protease inhibitor 9 (ovalbumin type) antibody
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 9 antibody
    • Serpin B9 antibody
    • Serpin peptidase inhibitor clade B (ovalbumin) member 9 antibody
    • Serpin peptidase inhibitor clade B member 9 antibody
    • SERPINB9 antibody
    • SPB9_HUMAN antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human bile duct cancer tissue stained for PI-9 using ab233443 at 10 µg/ml in immunohistochemical analysis.

    Secondary Antibody: 2 µg/ml HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody.

  • Anti-PI-9 antibody (ab233443) at 2 µg/ml + Mouse placenta lysate

    Predicted band size: 42 kDa

  • Anti-PI-9 antibody (ab233443) at 2 µg/ml + K562 (human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Predicted band size: 42 kDa

  • Anti-PI-9 antibody (ab233443) at 3 µg/ml + Human serum

    Predicted band size: 42 kDa

  • Anti-PI-9 antibody (ab233443) at 3 µg/ml + Recombinant human PI-9 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 42 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling PI-9 using ab233443 at 10 µg/ml in ICC/IF. FITC-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody was used as the secondary antibody at 1 µg/ml.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for PI-9 using ab233443 at 10 µg/ml in immunohistochemical analysis.

    Secondary Antibody: 2 µg/ml HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PI-9 using ab233443 at 10 µg/ml in immunohistochemical analysis.

    Secondary Antibody: 2µg/ml HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody.

  • Formalin-fixed, paraffin-embedded human prostate cancer tissue stained for PI-9 using ab233443 at 10 µg/ml in immunohistochemical analysis.

    Secondary Antibody: 2µg/ml HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for PI-9 using ab233443 at 10 µg/ml in immunohistochemical analysis.

    Secondary Antibody: 2 µg/ml HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for PI-9 using ab233443 at 10 µg/ml in immunohistochemical analysis.

    Secondary Antibody: 2 µg/ml HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody.

References

ab233443 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up