Overview

  • Product name

    Anti-PI3 Kinase p110 beta antibody
    See all PI3 Kinase p110 beta primary antibodies
  • Description

    Rabbit polyclonal to PI3 Kinase p110 beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PI3 Kinase p110 beta aa 807-1070. (Expressed in E.coli).
    Sequence:

    GDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVST SETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEEFTLSCA GYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERV PFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFAL MLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTK VNWMAHTVRKDYRS


    Database link: P42338

  • Positive control

    • WB: Pig cerebrum lysate; Mouse parotid gland lysate; Recombinant human PI3 Kinase p110 beta protein. IHC-P: Human prostate, liver cancer, liver, kidney and stomach tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab232997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Phosphorylates PtdIns, PtdIns4P and PtdIns(4,5)P2 with a preference for PtdIns(4,5)P2.
  • Tissue specificity

    Expressed ubiquitously.
  • Pathway

    Phospholipid metabolism; phosphatidylinositol phosphate biosynthesis.
  • Sequence similarities

    Belongs to the PI3/PI4-kinase family.
    Contains 1 PI3K/PI4K domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5-bisphosphate 3-kinase 110 kDa catalytic subunit beta antibody
    • 5-bisphosphate 3-kinase catalytic subunit beta isoform antibody
    • DKFZp779K1237 antibody
    • MGC133043 antibody
    • OTTHUMP00000216901 antibody
    • OTTHUMP00000216904 antibody
    • p110 BETA antibody
    • p110Beta antibody
    • Phosphatidylinositol 3 kinase catalytic beta polypeptide antibody
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase 110 kDa catalytic subunit beta antibody
    • Phosphatidylinositol 4 5 bisphosphate 3 kinase catalytic subunit beta isoform antibody
    • Phosphatidylinositol-4 antibody
    • Phosphoinositide 3 kinase catalytic beta polypeptide antibody
    • PI3 kinase p110 subunit beta antibody
    • PI3-kinase subunit beta antibody
    • PI3K antibody
    • PI3K beta antibody
    • PI3K-beta antibody
    • PI3Kbeta antibody
    • PI3KCB antibody
    • PIK3C1 antibody
    • Pik3cb antibody
    • PK3CB_HUMAN antibody
    • PtdIns 3 kinase p110 antibody
    • PtdIns-3-kinase subunit beta antibody
    • PtdIns-3-kinase subunit p110-beta antibody
    see all

Images

  • Anti-PI3 Kinase p110 beta antibody (ab232997) at 2 µg/ml + Mouse parotid gland lysate

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/1000 dilution
  • Formalin-fixed, paraffin-embedded human stomach tissue stained for PI3 Kinase p110 beta using ab232997 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PI3 Kinase p110 beta using ab232997 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver tissue stained for PI3 Kinase p110 beta using ab232997 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for PI3 Kinase p110 beta using ab232997 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for PI3 Kinase p110 beta using ab232997 at 30 µg/ml in immunohistochemical analysis. DAB staining.

  • HepG2 (human liver hepatocellular carcinoma cell line) stained for PI3 Kinase p110 beta (green) at 20 µg/mL in ICC/IF. FITC-labeled secondary antibody.

  • Anti-PI3 Kinase p110 beta antibody (ab232997) at 2 µg/ml + Pig cerebrum lysate
  • Anti-PI3 Kinase p110 beta antibody (ab232997) at 2 µg/ml + Recombinant human PI3 Kinase p110 beta protein

References

This product has been referenced in:

  • Wu YQ  et al. PABPC1L depletion inhibits proliferation and migration via blockage of AKT pathway in human colorectal cancer cells. Oncol Lett 17:3439-3445 (2019). Read more (PubMed: 30867782) »
  • Polo S  et al. Treatment With the Delta Opioid Agonist UFP-512 Alleviates Chronic Inflammatory and Neuropathic Pain: Mechanisms Implicated. Front Pharmacol 10:283 (2019). Read more (PubMed: 30971925) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up