Anti-PIAS3 antibody (ab221901)
Key features and details
- Rabbit polyclonal to PIAS3
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PIAS3 antibody
See all PIAS3 primary antibodies -
Description
Rabbit polyclonal to PIAS3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human PIAS3 aa 547-628.
Sequence:ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSI VAPGGALREGHGGPLPSGPSLTGCRSDIISLD
Database link: Q9Y6X2 -
Positive control
- ICC/IF: MCF7 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221901 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation (PubMed:21965678, PubMed:9388184). Sumoylates CCAR2 which promotes its interaction with SIRT1 (PubMed:25406032). Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus (PubMed:24651376). -
Tissue specificity
Widely expressed. -
Pathway
Protein modification; protein sumoylation. -
Sequence similarities
Belongs to the PIAS family.
Contains 1 PINIT domain.
Contains 1 SAP domain.
Contains 1 SP-RING-type zinc finger. -
Domain
The PINIT domain of PIAS3 is required for STAT3-PIAS3 interaction and for transloaction to the nucleus.
The LXXLL motif is a transcriptional coregulator signature. -
Post-translational
modificationsSumoylated. -
Cellular localization
Cytoplasm. Nucleus. Nucleus speckle. Colocalizes with MITF in the nucleus. Colocalizes with GFI1 in nuclear dots. Colocalizes with SUMO1 in nuclear granules. - Information by UniProt
-
Database links
- Entrez Gene: 10401 Human
- Entrez Gene: 229615 Mouse
- Entrez Gene: 83614 Rat
- Omim: 605987 Human
- SwissProt: Q9Y6X2 Human
- SwissProt: O54714 Mouse
- SwissProt: O70260 Rat
- Unigene: 435761 Human
see all -
Alternative names
- E3 SUMO protein ligase PIAS 3 antibody
- E3 SUMO protein ligase PIAS3 antibody
- E3 SUMO-protein ligase PIAS3 antibody
see all
Images
Protocols
Datasheets and documents
References (0)
ab221901 has not yet been referenced specifically in any publications.