Anti-PIAS3 antibody (ab221901)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-PIAS3 antibody
See all PIAS3 primary antibodies -
Description
Rabbit polyclonal to PIAS3 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat
-
Immunogen
Recombinant fragment corresponding to Human PIAS3 aa 547-628.
Sequence:ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSI VAPGGALREGHGGPLPSGPSLTGCRSDIISLD
Database link: Q9Y6X2 -
Positive control
- ICC/IF: MCF7 cells.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab221901 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
Target
-
Function
Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation (PubMed:21965678, PubMed:9388184). Sumoylates CCAR2 which promotes its interaction with SIRT1 (PubMed:25406032). Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus (PubMed:24651376). -
Tissue specificity
Widely expressed. -
Pathway
Protein modification; protein sumoylation. -
Sequence similarities
Belongs to the PIAS family.
Contains 1 PINIT domain.
Contains 1 SAP domain.
Contains 1 SP-RING-type zinc finger. -
Domain
The PINIT domain of PIAS3 is required for STAT3-PIAS3 interaction and for transloaction to the nucleus.
The LXXLL motif is a transcriptional coregulator signature. -
Post-translational
modificationsSumoylated. -
Cellular localization
Cytoplasm. Nucleus. Nucleus speckle. Colocalizes with MITF in the nucleus. Colocalizes with GFI1 in nuclear dots. Colocalizes with SUMO1 in nuclear granules. - Information by UniProt
-
Database links
- Entrez Gene: 10401 Human
- Entrez Gene: 229615 Mouse
- Entrez Gene: 83614 Rat
- Omim: 605987 Human
- SwissProt: Q9Y6X2 Human
- SwissProt: O54714 Mouse
- SwissProt: O70260 Rat
- Unigene: 435761 Human
see all -
Alternative names
- E3 SUMO protein ligase PIAS 3 antibody
- E3 SUMO protein ligase PIAS3 antibody
- E3 SUMO-protein ligase PIAS3 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-PIAS3 antibody (ab221901)PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for PIAS3 (green) using ab221901 at 4 µg/ml in ICC/IF.
Datasheets and documents
References
ab221901 has not yet been referenced specifically in any publications.
