For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    pias3-antibody-ab221901.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Proteolysis / Ubiquitin Proteasome / Ubiquitin Sumo
Share by email

Anti-PIAS3 antibody (ab221901)

  • Datasheet
Reviews (1) Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunocytochemistry/ Immunofluorescence - Anti-PIAS3 antibody (ab221901)

    Key features and details

    • Rabbit polyclonal to PIAS3
    • Suitable for: ICC/IF
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-PIAS3 antibody
      See all PIAS3 primary antibodies
    • Description

      Rabbit polyclonal to PIAS3
    • Host species

      Rabbit
    • Tested applications

      Suitable for: ICC/IFmore details
    • Species reactivity

      Reacts with: Human
      Predicted to work with: Mouse, Rat
    • Immunogen

      Recombinant fragment corresponding to Human PIAS3 aa 547-628.
      Sequence:

      ITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHCSATPAPPPGRVSSI VAPGGALREGHGGPLPSGPSLTGCRSDIISLD


      Database link: Q9Y6X2
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • ICC/IF: MCF7 cells.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.20
      Preservative: 0.02% Sodium azide
      Constituents: 40% Glycerol (glycerin, glycerine), PBS
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Cell Biology
      • Proteolysis / Ubiquitin
      • Proteasome / Ubiquitin
      • Sumo
      • Epigenetics and Nuclear Signaling
      • Transcription
      • Other factors
      • Epigenetics and Nuclear Signaling
      • Transcription
      • Transcription Factors
      • Epigenetics and Nuclear Signaling
      • Ubiquitin & Ubiquitin Like Modifiers
      • Ubiquitin like Modifiers

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

    Applications

    Our Abpromise guarantee covers the use of ab221901 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    ICC/IF Use a concentration of 0.25 - 2 µg/ml.

    Fixation/Permeabilization: PFA/Triton X-100.

    Target

    • Function

      Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation (PubMed:21965678, PubMed:9388184). Sumoylates CCAR2 which promotes its interaction with SIRT1 (PubMed:25406032). Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus (PubMed:24651376).
    • Tissue specificity

      Widely expressed.
    • Pathway

      Protein modification; protein sumoylation.
    • Sequence similarities

      Belongs to the PIAS family.
      Contains 1 PINIT domain.
      Contains 1 SAP domain.
      Contains 1 SP-RING-type zinc finger.
    • Domain

      The PINIT domain of PIAS3 is required for STAT3-PIAS3 interaction and for transloaction to the nucleus.
      The LXXLL motif is a transcriptional coregulator signature.
    • Post-translational
      modifications

      Sumoylated.
    • Cellular localization

      Cytoplasm. Nucleus. Nucleus speckle. Colocalizes with MITF in the nucleus. Colocalizes with GFI1 in nuclear dots. Colocalizes with SUMO1 in nuclear granules.
    • Target information above from: UniProt accession Q9Y6X2 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 10401 Human
      • Entrez Gene: 229615 Mouse
      • Entrez Gene: 83614 Rat
      • Omim: 605987 Human
      • SwissProt: Q9Y6X2 Human
      • SwissProt: O54714 Mouse
      • SwissProt: O70260 Rat
      • Unigene: 435761 Human
      • Unigene: 1635 Mouse
      • Unigene: 14548 Rat
      see all
    • Alternative names

      • E3 SUMO protein ligase PIAS 3 antibody
      • E3 SUMO protein ligase PIAS3 antibody
      • E3 SUMO-protein ligase PIAS3 antibody
      • FLJ14651 antibody
      • OTTHUMP00000015586 antibody
      • OTTHUMP00000015587 antibody
      • PIAS 3 antibody
      • Pias3 antibody
      • PIAS3 protein antibody
      • PIAS3_HUMAN antibody
      • Protein inhibitor of activated STAT 3 antibody
      • Protein inhibitor of activated STAT protein 3 antibody
      • Protein inhibitor of activated STAT3 antibody
      • Zinc finger MIZ type containing 5 antibody
      • ZMIZ 5 antibody
      • ZMIZ5 antibody
      see all

    Images

    • Immunocytochemistry/ Immunofluorescence - Anti-PIAS3 antibody (ab221901)
      Immunocytochemistry/ Immunofluorescence - Anti-PIAS3 antibody (ab221901)

      PFA-fixed, Triton X-100 permeabilized MCF7 (human breast adenocarcinoma cell line) cells stained for PIAS3 (green) using ab221901 at 4 µg/ml in ICC/IF.

    Protocols

    • Immunocytochemistry & immunofluorescence protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab221901? Please let us know so that we can cite the reference in this datasheet.

    ab221901 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Western blot abreview for Anti-PIAS3 antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Human Cell lysate - whole cell (HAP1)
    Gel Running Conditions
    Reduced Denaturing (10%)
    Loading amount
    40 µg
    Specification
    HAP1
    Blocking step
    Milk as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Apr 19 2019

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.