Overview

  • Product name
  • Description
    Rabbit polyclonal to PIAS3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Cow, Dog
  • Immunogen

    Synthetic peptide: HYGPSVITSL DEQDALGHFF QYRGTPSHFL GPLAPTLGSS HCSATPAPPP, corresponding to a sequence within C terminal amino acids 541-590 of Human PIAS3

  • Positive control
    • HepG2 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab22856 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 2 µg/ml. Detects a band of approximately 68 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.

Target

  • Function
    Functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. Plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway and the steroid hormone signaling pathway. Involved in regulating STAT3 signaling via inhibiting STAT3 DNA-binding and suppressing cell growth. Enhances the sumoylation of MTA1 and may participate in its paralog-selective sumoylation (PubMed:21965678, PubMed:9388184). Sumoylates CCAR2 which promotes its interaction with SIRT1 (PubMed:25406032). Diminishes the sumoylation of ZFHX3 by preventing the colocalization of ZFHX3 with SUMO1 in the nucleus (PubMed:24651376).
  • Tissue specificity
    Widely expressed.
  • Pathway
    Protein modification; protein sumoylation.
  • Sequence similarities
    Belongs to the PIAS family.
    Contains 1 PINIT domain.
    Contains 1 SAP domain.
    Contains 1 SP-RING-type zinc finger.
  • Domain
    The PINIT domain of PIAS3 is required for STAT3-PIAS3 interaction and for transloaction to the nucleus.
    The LXXLL motif is a transcriptional coregulator signature.
  • Post-translational
    modifications
    Sumoylated.
  • Cellular localization
    Cytoplasm. Nucleus. Nucleus speckle. Colocalizes with MITF in the nucleus. Colocalizes with GFI1 in nuclear dots. Colocalizes with SUMO1 in nuclear granules.
  • Information by UniProt
  • Database links
  • Alternative names
    • E3 SUMO protein ligase PIAS 3 antibody
    • E3 SUMO protein ligase PIAS3 antibody
    • E3 SUMO-protein ligase PIAS3 antibody
    • FLJ14651 antibody
    • OTTHUMP00000015586 antibody
    • OTTHUMP00000015587 antibody
    • PIAS 3 antibody
    • Pias3 antibody
    • PIAS3 protein antibody
    • PIAS3_HUMAN antibody
    • Protein inhibitor of activated STAT 3 antibody
    • Protein inhibitor of activated STAT protein 3 antibody
    • Protein inhibitor of activated STAT3 antibody
    • Zinc finger MIZ type containing 5 antibody
    • ZMIZ 5 antibody
    • ZMIZ5 antibody
    see all

Images

  • Anti-PIAS3 antibody (ab22856) at 0.004 µg/ml + HepG2 cell lysate

    Secondary
    HRP conjugated anti-Rabbit IgG should be diluted in 1/50,000 - 100,000

    Performed under reducing conditions.

    Observed band size: 68 kDa
    why is the actual band size different from the predicted?

  • ab22856, at a 1/125-250 dilution, staining human PIAS3 in human liver by Immunohistochemistry, Paraffin embedded tissue. Positive stained hepatocytes indicated by arrows. Magnification 400 x.

References

This product has been referenced in:
  • Campia I  et al. An Autocrine Cytokine/JAK/STAT-Signaling Induces Kynurenine Synthesis in Multidrug Resistant Human Cancer Cells. PLoS One 10:e0126159 (2015). WB . Read more (PubMed: 25955018) »
  • Izumi K  et al. Targeting the androgen receptor with siRNA promotes prostate cancer metastasis through enhanced macrophage recruitment via CCL2/CCR2-induced STAT3 activation. EMBO Mol Med 5:1383-401 (2013). Read more (PubMed: 23982944) »
See all 5 Publications for this product

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Answer

Muchas gracias por tu respuesta.

Si te corre prisa, lo mejor es que pidáis como dices ab22856. Este anticuerpo esta en stock, y en uno o dos días laborables deberíais recibirlo. Os mandaremos un mail automático con más detalles del pedido.

El número de referencia de éste es xxxx. Este anticuerpo debería funcionaros perfectamente, pero en caso de no hacerlo, también tiene una garantía de 6 meses, por lo que te ruego que nos contactes llegado el caso.

Espero de cualquier forma que este anticuerpo os funcione como esperáis, y para cualquier otra consulta, no dudes en volvernos a contactar.

Read More

Question
Answer

Thank you for your enquiry. The immunogen for this antibody is 100% homologous with mouse. I hope this information helps, please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for your enquiry. We do not routinely offer free or trial sized samples for testing purposes. Our policy at Abcam is that if an antibody does not work as specified on the datasheet, we will offer a replacement or reimbursement. Should you decide to go ahead and purchase this product, please let us know how you get on by submitting an Abreview and in return we will offer you 50 Abpoints which can be redeemed on a number of rewards (a further 100 Abpoints will be offered for an image). Please contact us again if you have any additional questions.

Read More

Answer

Thank you for your enquiry and patience. The region of PIAS3 from which the peptide was chosen was: LSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDALGHFFQY (from AA residue 499 to AA residue 553) If you have any additional questions, please contact us again.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up