Overview

  • Product name

  • Description

    Rabbit polyclonal to PIGN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PIGN aa 82-177.
    Sequence:

    SWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSLFNESK YTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTW


    Database link: O95427

  • Positive control

    • IHC-P: Human rectum tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Relevance

    PIGN is a ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis. PIGN transfers ethanolamine phosphate to the first alpha-1,4-linked mannose of the glycosylphosphatidylinositol precursor of GPI-anchor.
  • Cellular localization

    Endoplasmic reticulum membrane; Multipass membrane protein
  • Database links

  • Alternative names

    • Phosphatidylinositol glycan, class N antibody
    • GPI ethanolamine phosphate transferase 1 antibody
    • MCD4 antibody
    • MCD4 homolog antibody
    • MGC26427 antibody
    • Phosphatidylinositol glycan biosynthesis class N antibody
    • Phosphatidylinositol glycan biosynthesis class N protein antibody
    • PIG N antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for PIGN (green) using ab243799 at 4 µg/ml in ICC/IF.

  • Formalin-fixed, paraffin-embedded human rectum tissue stained for PIGN using ab243799 at 1/50 dilution in immunohistochemical analysis.

References

ab243799 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243799.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up