Overview

  • Product name

    Anti-PIGP antibody
  • Description

    Rabbit polyclonal to PIGP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PIGP aa 101-157.
    Sequence:

    NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLA AKELYTK


    Database link: P57054

  • Positive control

    • WB: PIGP overexpressing HEK-293T cell lysate. IHC-P: Human stomach tissue. ICC/IF: U-251 MG cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 18 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.
  • Tissue specificity

    Ubiquitous.
  • Pathway

    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Sequence similarities

    Belongs to the PIGP family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • DCRC antibody
    • DCRC S antibody
    • Down syndrome critical region gene 5 antibody
    • Down syndrome critical region protein 5 antibody
    • Down syndrome critical region protein C antibody
    • DSCR 5 antibody
    • DSCR5 antibody
    • DSCRC antibody
    • DSRC antibody
    • Phosphatidylinositol glycan anchor biosynthesis class P antibody
    • Phosphatidylinositol glycan biosynthesis class P antibody
    • Phosphatidylinositol glycan biosynthesis class P protein antibody
    • Phosphatidylinositol glycan class P antibody
    • Phosphatidylinositol n acetylglucosaminyltranferase subunit antibody
    • Phosphatidylinositol N acetylglucosaminyltransferase subunit P antibody
    • Phosphatidylinositol N-acetylglucosaminyltransferase subunit P antibody
    • Phosphatidylinositol-glycan biosynthesis class P protein antibody
    • PIG-P antibody
    • PIGP antibody
    • PIGP_HUMAN antibody
    see all

Images

  • All lanes : Anti-PIGP antibody (ab224128) at 1/100 dilution

    Lane 1 : Vector only transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : PIGP overexpressing HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate

    Developed using the ECL technique.

    Predicted band size: 18 kDa

  • Paraffin-embedded human stomach tissue stained for PIGP using ab224128 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-251 MG (human brain glioma cell line) cells stained for PIGP (green) using ab224128 at 4 µg/ml in ICC/IF.

References

ab224128 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up