Overview

  • Product name

  • Description

    Rabbit polyclonal to PIGT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human PIGT aa 402-562.
    Sequence:

    ITSKGKENKPSYIHYQPAQDRLQPHLLEMLIQLPANSVTKVSIQFERALL KWTEYTPDPNHGFYVSPSVLSALVPSMVAAKPVDWEESPLFNSLFPVSDG SNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCYGSFYNLLTRTF HIEEPRTGGLA


    Database link: Q969N2

  • Positive control

    • IHC-P: Human brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237800 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    PIGT is an essential component of the multisubunit enzyme, GPI transamidase and is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells which serves to anchor proteins to the cell surface. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.
  • Cellular localization

    Endoplasmic reticulum membrane; Single-pass type I membrane protein.
  • Database links

  • Alternative names

    • CGI 06 antibody
    • FLJ41596 antibody
    • GPI transamidase component PIG T antibody
    • GPI transamidase subunit antibody
    • MGC8909 antibody
    • NDAP antibody
    • Neurotrophin regulated neuronal development associated protein antibody
    • Phosphatidyl inositol glycan class T antibody
    • Phosphatidylinositol glycan anchor biosynthesis class T antibody
    • Phosphatidylinositol glycan class T antibody
    see all

Images

  • Paraffin-embedded human brain tissue stained for PIGT using ab237800 at 1/500 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab237800 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237800.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up