Overview

  • Product name

  • Description

    Rabbit polyclonal to PIGV
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PIGV aa 400-469.
    Sequence:

    QVLTRFLGSSTPIMYWFPAHLLQDQEPLLRSLKTVPWKPLAEDSPPGQKV PRNPIMGLLYHWKTCSPVTR


    Database link: Q9NUD9

  • Positive control

    • WB: A549 whole cell lysate. IHC-P: Human kidney tissue. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237692 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.
WB 1/500 - 1/5000. Predicted molecular weight: 56 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Alpha-1,6-mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the second mannose to the glycosylphosphatidylinositol during GPI precursor assembly.
  • Pathway

    Glycolipid biosynthesis; glycosylphosphatidylinositol-anchor biosynthesis.
  • Involvement in disease

    Defects in PIGV are the cause of hyperphosphatasia with mental retardation (HPMR) [MIM:239300]. It is a syndrome characterized by elevated serum alkaline phosphatase, severe mental retardation, seizures, hypotonia, facial dysmorphism, and hypoplastic terminal phalanges.
  • Sequence similarities

    Belongs to the PIGV family.
  • Post-translational
    modifications

    Not N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GPI mannosyltransferase 2 antibody
    • GPI mannosyltransferase II antibody
    • GPI MT II antibody
    • GPI-MT-II antibody
    • Phosphatidylinositol glycan biosynthesis class V protein antibody
    • Phosphatidylinositol-glycan biosynthesis class V protein antibody
    • PIG-V antibody
    • Pigv antibody
    • PIGV_HUMAN antibody
    see all

Images

  • Anti-PIGV antibody (ab237692) at 1/500 dilution + A549 (human lung carcinoma cell line) whole cell lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 56 kDa

  • Paraffin-embedded human kidney tissue stained for PIGV using ab237692 at 1/200 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for PIGV (Green) using ab237692 at 1/66 dilution in ICC/IF, followed by Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

References

ab237692 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237692.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up