Overview

  • Product name

    Anti-PIH1D1 antibody
  • Description

    Rabbit polyclonal to PIH1D1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IF, IPmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human PIH1D1 aa 1-290.
    Sequence:

    MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQP QPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIP MSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGL EDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGR AESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQ QLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS


    Database link: Q9NWS0-1

  • Positive control

    • IHC-P: Human placenta tissue. ICC/IF: HeLa cells. IP: HeLa whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238862 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/500.
IP 1/200 - 1/2000.

Target

Images

  • Paraffin-embedded human placenta tissue stained for PIH1D1 using ab238862 at 1/100 dilution in immunohistochemical analysis.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for PIH1D1 (green) using ab238862 at 1/200 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L). The nuclear counterstain is DAPI.

    The cells were fixed in 4% formaldehyde, permeabilized tissue using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the antibody overnight at 4°C.

     

  • PIH1D1 was immunoprecipitated from 0.5 mg HeLa (Human epithelial cell line from cervix adenocarcinoma) whole cell lysate with ab238862 at 1/200 dilution.

    Lane 1: Control rabbit IgG IP (1 μg) in HeLa whole cell lysate.
    Lane 2: ab238862 IP in HeLa whole cell lysate.
    Lane 3: HeLa whole cell lysate 10 μg (Input).

    For Western blotting, a HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

This product has been referenced in:

  • Morwitzer MJ  et al. Identification of RUVBL1 and RUVBL2 as Novel Cellular Interactors of the Ebola Virus Nucleoprotein. Viruses 11:N/A (2019). Read more (PubMed: 31018511) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238862.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up