Overview

  • Product name

  • Description

    Rabbit polyclonal to PIK3C2B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PIK3C2B aa 316-411.
    Sequence:

    PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAV TPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY


    Database link: O00750

  • Positive control

    • ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Relevance

    The protein encoded by this gene belongs to the phosphoinositide 3-kinase (PI3K) family. PI3-kinases play roles in signaling pathways involved in cell proliferation, oncogenic transformation, cell survival, cell migration, and intracellular protein trafficking. This protein contains a lipid kinase catalytic domain as well as a C-terminal C2 domain, a characteristic of class II PI3-kinases. C2 domains act as calcium-dependent phospholipid binding motifs that mediate translocation of proteins to membranes, and may also mediate protein-protein interactions. The PI3-kinase activity of this protein is sensitive to low nanomolar levels of the inhibitor wortmanin. The C2 domain of this protein was shown to bind phospholipids but not Ca2+, which suggests that this enzyme may function in a calcium-independent manner.
  • Cellular localization

    Microsome. Cell membrane. Cytoplasm, cytosol. Nucleus. Note=Found mostly in the microsome, but also in the plasma membrane and cytosol. Nuclear in testis.
  • Database links

  • Alternative names

    • C2 PI3K antibody
    • phosphatidylinositol 3-kinase C2 domain-containing beta polypeptide antibody
    • phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta antibody
    • phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta antibody
    • Phosphoinositide 3 Kinase C2 beta antibody
    • Phosphoinositide 3-Kinase class 2, beta antibody
    • phosphoinositide-3-kinase, class 2, beta polypeptide antibody
    • PI3K C2beta antibody
    • PtdIns 3 kinase C2 beta antibody
    • PTDINS-3-kinase C2 beta antibody
    • ptdIns-3-kinase C2 subunit beta antibody
    see all

Images

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized A431 cells labeling PIK3C2B with ab220752 at 4 μg/mL dilution (green). 

References

ab220752 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up