Overview

  • Product name

    Anti-Pin1 antibody - N-terminal
    See all Pin1 primary antibodies
  • Description

    Rabbit polyclonal to Pin1 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Synthetic peptide within Human Pin1 aa 1-50 (N terminal). The exact sequence is proprietary. (NP_006212.1).
    Sequence:

    MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQG


    Database link: Q13526

  • Positive control

    • Human cerebellum tissue; NIH 3T3 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab189321 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/100 - 1/500.
IHC-P Use a concentration of 20 µg/ml.

Target

  • Function

    Essential PPIase that regulates mitosis presumably by interacting with NIMA and attenuating its mitosis-promoting activity. Displays a preference for an acidic residue N-terminal to the isomerized proline bond. Catalyzing pSer/Thr-Pro cis/trans isomerizations.
  • Sequence similarities

    Contains 1 PpiC domain.
    Contains 1 WW domain.
  • Domain

    The WW domain is required for the interaction with STIL and KIF20B.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DOD antibody
    • DODO, Drosophila, homolog of antibody
    • FLJ40239 antibody
    • FLJ77628 antibody
    • MGC10717 antibody
    • NIMA interacting 1 antibody
    • Peptidyl prolyl cis trans isomerase NIMA interacting 1 antibody
    • Peptidyl prolyl cis/trans isomerase NIMA interacting antibody
    • Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 antibody
    • Peptidyl-prolyl cis-trans isomerase pin1 antibody
    • Peptidylprolyl cis/trans isomerase NIMA interacting 1 antibody
    • Pin 1 antibody
    • Pin1 antibody
    • PIN1_HUMAN antibody
    • PPIase Pin1 antibody
    • Prolyl isomerase antibody
    • Protein (peptidylprolyl cis/trans isomerase) NIMA interacting 1 antibody
    • Protein NIMA interacting 1 antibody
    • Rotamase Pin1 antibody
    • UBL 5 antibody
    • UBL5 antibody
    see all

Images

  • Immunofluorescent analysis of NIH 3T3 cells labeling Pin1 with ab189321 at 1/100 dilution, in the presence (right panel) or absence (left panel) of immunizing peptide.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human cerebellum tissue labeling Pin1 with ab189321 at 20 µg/ml.

References

ab189321 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189321.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up