Overview

  • Product name

  • Description

    Rabbit polyclonal to PIN4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant full length protein corresponding to Human PIN4 aa 1-131.
    Sequence:

    MPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGK IMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFA LPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK


    Database link: Q9Y237-1

  • Positive control

    • WB: HEK-293T, RAW 264.7 and HepG2 whole cell lysates; Mouse and rat liver tissue lysates. IHC-P: Human testis tissue. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 13 kDa.
ICC/IF 1/200 - 1/500.
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Isoform 1 is involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.
    Isoform 2 binds to double-stranded DNA.
  • Tissue specificity

    Isoform 2 is much more stable than isoform 1 (at protein level). Ubiquitous. Isoform 1 and isoform 2 are expressed in kidney, liver, blood vessel, brain, mammary gland, skeletal muscle, small intestine and submandibularis. Isoform 1 transcripts are much more abundant than isoform 2 in each tissue analyzed.
  • Sequence similarities

    Belongs to the ppiC/parvulin rotamase family. PIN4 subfamily.
    Contains 1 PpiC domain.
  • Domain

    The PPIase domain enhances mitochondrial targeting.
  • Post-translational
    modifications

    Phosphorylated. Isoform 1 phosphorylation occurs both in the nucleus and the cytoplasm. Isoform 1 phosphorylation at Ser-19 does not affect its PPIase activity but is required for nuclear localization, and the dephosphorylation is a prerequisite for the binding to DNA. The unphosphorylated isoform 1 associates with the pre-rRNP complexes in the nucleus.
    Isoform 2 is sumoylated by SUMO2 and SUMO3.
  • Cellular localization

    Mitochondrion. Mitochondrion matrix. Imported in a time- and membrane potential-dependent manner to the mitochondrial matrix, but without concomitant processing of the protein. Directed to mitochondria by a novel N-terminal domain that functions as non-cleavable mitochondrial targeting peptide and Nucleus > nucleolus. Cytoplasm > cytoskeleton > spindle. Cytoplasm. Colocalizes in the nucleolus during interphase and on the spindle apparatus during mitosis with NPM1.
  • Information by UniProt
  • Database links

  • Alternative names

    • EPVH antibody
    • Eukaryotic parvulin homolog antibody
    • hEPVH antibody
    • hPar14 antibody
    • hPar17 antibody
    • MGC138486 antibody
    • OTTHUMP00000023527 antibody
    • OTTHUMP00000217483 antibody
    • OTTHUMP00000217485 antibody
    • Par14 antibody
    • Par17 antibody
    • Parvulin 14 antibody
    • Parvulin-14 antibody
    • Parvulin-17 antibody
    • Peptidyl prolyl cis trans isomerase NIMA interacting 4 antibody
    • Peptidyl prolyl cis/trans isomerase EPVH antibody
    • Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 antibody
    • Peptidyl-prolyl cis-trans isomerase PIN4 antibody
    • Peptidyl-prolyl cis/trans isomerase EPVH antibody
    • PIN4 antibody
    • PIN4_HUMAN antibody
    • PPIase Pin4 antibody
    • Protein (peptidylprolyl cis/trans isomerase) NIMA interacting, 4 (parvulin) antibody
    • Rotamase Pin4 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for PIN4 using ab237619 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for PIN4 (green) using ab237619 at 1/266 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

  • All lanes : Anti-PIN4 antibody (ab237619) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : RAW 264.7 (mouse macrophage cell line transformed with Abelson murine leukemia virus) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : Rat liver tissue lysate
    Lane 5 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 13 kDa

References

ab237619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up