Overview

  • Product name

  • Description

    Rabbit polyclonal to PINCH 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PINCH 1 aa 68-303. Two N-terminal tags, expressed in E.coli.
    Sequence:

    APCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHL CRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKE LTADARELKGELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHF VCAKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVVSAL NKAWCVNCFACSTCNTKLTLKNKFVEFDMKPVCKKC


    Database link: P48059-1

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human PINCH 1 protein; Human lung and liver lysate; Jurkat lysate; Pig kidney and spleen lysates.
  • General notes

    Previously labelled as LIMS1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab233422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 37 kDa.

Target

  • Function

    Effector of integrin and growth factor signaling, coupling surface receptors to downstream signaling molecules involved in the regulation of cell survival, cell proliferation and cell differentiation. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway.
  • Tissue specificity

    Expressed in most tissues except in the brain.
  • Sequence similarities

    Contains 5 LIM zinc-binding domains.
  • Cellular localization

    Cell junction > focal adhesion. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2310016J22Rik antibody
    • 4921524A02Rik antibody
    • AI507642 antibody
    • AU021743 antibody
    • AW551584 antibody
    • C430041B13Rik antibody
    • LIM and senescent cell antigen like domains 1 antibody
    • LIM and senescent cell antigen-like-containing domain protein 1 antibody
    • LIM zinc finger domain containing 1 antibody
    • LIM-type zinc finger domains 1 antibody
    • Lims1 antibody
    • LIMS1_HUMAN antibody
    • Lims1l antibody
    • Particularly interesting new Cys His protein 1 antibody
    • Particularly interesting new Cys His protein antibody
    • Particularly interesting new Cys-His protein 1 antibody
    • PINCH 1 antibody
    • PINCH antibody
    • PINCH-1 antibody
    • PINCH1 antibody
    • Renal carcinoma antigen NY REN 48 antibody
    • Renal carcinoma antigen NY-REN-48 antibody
    • senescent cell antigen antibody
    • wu:fc32c03 antibody
    • zgc:112533 antibody
    see all

Images

  • Anti-PINCH 1 antibody (ab233422) at 2 µg/ml + Human liver tissue lysate.

    Predicted band size: 37 kDa

  • Anti-PINCH 1 antibody (ab233422) at 1 µg/ml + Pig spleen tissue lysate.

    Predicted band size: 37 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PINCH 1 using ab233422 at 20µg/mL in immunohistochemical analysis. DAB staining.

  • Anti-PINCH 1 antibody (ab233422) at 2 µg/ml + Pig kidney tissue lysate.

    Predicted band size: 37 kDa

  • Anti-PINCH 1 antibody (ab233422) at 2 µg/ml + Jurkat (human T cell leukemia cell line from peripheral blood) cell lysate.

    Predicted band size: 37 kDa

  • Anti-PINCH 1 antibody (ab233422) at 2 µg/ml + Human lung tissue lysate.

    Predicted band size: 37 kDa

  • Anti-PINCH 1 antibody (ab233422) at 2 µg/ml + Recombinant human LIMS1 protein.

    Predicted band size: 37 kDa

References

ab233422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up