Overview

  • Product name

    Anti-PINK1 antibody [N4/15]
    See all PINK1 primary antibodies
  • Description

    Mouse monoclonal [N4/15] to PINK1
  • Host species

    Mouse
  • Specificity

    >30% identity with DMPK.
  • Tested applications

    Suitable for: IHC-Fr, WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human PINK1 aa 112-496. NP_115785.1.
    Sequence:

    EEKQAESRRAVSACQEIQAIFTQKSKPGPDPLDTRRLQGFRLEEYLIGQS IGKGCSAAVYEATMPTLPQNLEVTKSTGLLPGRGPGTSAPGEGQERAPGA PAFPLAIKMMWNISAGSSSEAILNTMSQELVPASRVALAGEYGAVTYRKS KRGPKQLAPHPNIIRVLRAFTSSVPLLPGALVDYPDVLPSRLHPEGLGHG RTLFLVMKNYPCTLRQYLCVNTPSPRLAAMMLLQLLEGVDHLVQQGIAHR DLKSDNILVELDPDGCPWLVIADFGCCLADESIGLQLPFSSWYVDRGGNG CLMAPEVSTARPGPRAVIDYSKADAWAVGAIAYEIFGLVNPFYGQGKAHL ESRSYQEAQLPALPESVPPDVRQLVRALLQREASK


    Database link: Q9BXM7

  • Positive control

    • WB: Rat brain lysate. ICC/IF: SK-N-BE cells.
  • General notes

    The clone number has been updated from S4-15 to N4/15, both clone numbers name the same antibody clone.

     

Properties

Applications

Our Abpromise guarantee covers the use of ab186303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration.
WB 1/1000. Predicted molecular weight: 63 kDa.
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Function

    Protects against mitochondrial dysfunction during cellular stress, potentially by phosphorylating mitochondrial proteins. Involved in the clearance of damaged mitochondria via selective autophagy (mitophagy). It is necessary for PARK2 recruitement to dysfunctional mitochondria to initiate their degradation.
  • Tissue specificity

    Highly expressed in heart, skeletal muscle and testis, and at lower levels in brain, placenta, liver, kidney, pancreas, prostate, ovary and small intestine. Present in the embryonic testis from an early stage of development.
  • Involvement in disease

    Defects in PINK1 are the cause of Parkinson disease type 6 (PARK6) [MIM:605909]. A neurodegenerative disorder characterized by parkinsonian signs such as rigidity, resting tremor and bradykinesia. A subset of patients manifest additional symptoms including hyperreflexia, autonomic instability, dementia and psychiatric disturbances. Symptoms show diurnal fluctuation and can improve after sleep.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Mitochondrion outer membrane. Cytoplasm > cytosol.
  • Information by UniProt
  • Database links

  • Alternative names

    • BRPK antibody
    • FLJ27236 antibody
    • mitochondrial antibody
    • PARK 6 antibody
    • PARK6 antibody
    • Phosphatase and Tensin Homolog antibody
    • PINK 1 antibody
    • PINK1 antibody
    • PINK1_HUMAN antibody
    • Protein kinase BRPK antibody
    • PTEN induced putative kinase 1 antibody
    • PTEN induced putative kinase protein 1 antibody
    • PTEN-induced putative kinase protein 1 antibody
    • Serine/threonine kinase PINK1 mitochondrial antibody
    • Serine/threonine protein kinase PINK1 mitochondrial antibody
    • Serine/threonine-protein kinase PINK1 antibody
    see all

Images

  • SK-N-BE (Human neuroblastoma cell line) cells stained for PINK1 using ab186303 at a dilution of 1/100 (1 hour at RT) in ICC/IF.

    Cells were fixed in 4% formaldehyde for 15 minutes at RT.

    Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 1 hour at RT.

  • Anti-PINK1 antibody [N4/15] (ab186303) at 1/200 dilution + Rat brain lysate at 15 µg

    Secondary
    Goat Anti-Mouse IgG: HRP at 1/1000 dilution

    Developed using the ECL technique.

    Predicted band size: 63 kDa


    Exposure time: 6 minutes


    Block: 2% BSA and 2% skimmed milk in 1X TBST.

    Incubated with primary antibody for 16 hours at 4°C.

    Incubated with secondary antibody for 1 hour at RT.

References

This product has been referenced in:

  • Che Y  et al. Role of autophagy in a model of obesity: A long-term high fat diet induces cardiac dysfunction. Mol Med Rep 18:3251-3261 (2018). Read more (PubMed: 30066870) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up