Overview

  • Product name

  • Description

    Rabbit polyclonal to Pinkbar
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Pinkbar aa 351-499.
    Sequence:

    VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMT SMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQ SRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP


    Database link: Q6UXY1

  • Positive control

    • IHC-P: Human small intestine tissue.
  • General notes

    Previously labelled as BAIAP2L2.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May function as an adapter protein.
  • Sequence similarities

    Contains 1 IMD (IRSp53/MIM homology) domain.
    Contains 1 SH3 domain.
  • Domain

    The IMD domain is predicted to have a helical structure. It may induce actin bundling and filopodia formation.
  • Information by UniProt
  • Database links

  • Alternative names

    • BAI1-associated protein 2-like 2 antibody
    • BAI1-associated protein 2-like protein 2 antibody
    • baiap2l2 antibody
    • BAIAP2L2 BAI1-associated protein 2-like 2 antibody
    • BC048937 antibody
    • BI2L2_HUMAN antibody
    • Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 antibody
    • FLJ22582 antibody
    • Pinkbar antibody
    • Planar intestinal- and kidney-specific BAR domain protein antibody
    • RP5-1039K5.3 antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for Pinkbar using ab224323 at 1/50 dilution in immunohistochemical analysis.

References

ab224323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up