Overview

  • Product name

  • Description

    Rabbit polyclonal to PINX1/LPTS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human PINX1/LPTS aa 85-133 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    NQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGK


    Database link: Q96BK5

  • Positive control

    • IHC-P; Mouse kidney tissue.
  • General notes

     This product was previously labelled as PINX1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217960 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.
  • Tissue specificity

    Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines.
  • Sequence similarities

    Belongs to the PINX1 family.
    Contains 1 G-patch domain.
  • Domain

    The TID (telomerase inhibiting domain) domain is sufficient to bind TERT and inhibit its activity.
    The TBM domain mediates interaction with TERF1.
  • Cellular localization

    Nucleus. Nucleus > nucleolus. Chromosome > telomere. Chromosome > centromere > kinetochore. Localizes in nucleoli, at telomere speckles and to the outer plate of kinetochores. Localization to the kinetochore is mediated by its central region and depends on NDC80 and CENPE.
  • Information by UniProt
  • Database links

  • Alternative names

    • 67-11-3 protein antibody
    • FLJ20565 antibody
    • Hepatocellular carcinoma-related putative tumor suppressor antibody
    • Liver-related putative tumor suppressor antibody
    • LPTL antibody
    • LPTS antibody
    • MGC8850 antibody
    • OTTHUMP00000224984 antibody
    • OTTHUMP00000224985 antibody
    • OTTHUMP00000224986 antibody
    • OTTHUMP00000225053 antibody
    • OTTHUMP00000225054 antibody
    • PIN2 interacting protein 1 antibody
    • Pin2-interacting protein X1 antibody
    • PIN2/TERF1-interacting telomerase inhibitor 1 antibody
    • PINX1 antibody
    • PINX1_HUMAN antibody
    • Protein 67-11-3 antibody
    • TRF1-interacting protein 1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Mouse kidney tissue labeling PINX1/LPTS with ab217960 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

ab217960 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217960.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up