Overview

  • Product name

    Anti-PINX1/LPTS antibody - N-terminal
    See all PINX1/LPTS primary antibodies
  • Description

    Mouse polyclonal to PINX1/LPTS - N-terminal
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human PINX1/LPTS aa 1-100 (N terminal). (AAH15479).
    Sequence:

    MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEH GATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETT


    Database link: Q96BK5

  • Positive control

    • IMR-32 cell lysate.
  • General notes

     This product was previously labelled as PINX1

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 50% Glycerol
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab194463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 37 kDa.

Target

  • Function

    Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.
  • Tissue specificity

    Ubiquitous; expressed at low levels. Not detectable in a number of hepatocarcinoma cell lines.
  • Sequence similarities

    Belongs to the PINX1 family.
    Contains 1 G-patch domain.
  • Domain

    The TID (telomerase inhibiting domain) domain is sufficient to bind TERT and inhibit its activity.
    The TBM domain mediates interaction with TERF1.
  • Cellular localization

    Nucleus. Nucleus > nucleolus. Chromosome > telomere. Chromosome > centromere > kinetochore. Localizes in nucleoli, at telomere speckles and to the outer plate of kinetochores. Localization to the kinetochore is mediated by its central region and depends on NDC80 and CENPE.
  • Information by UniProt
  • Database links

  • Alternative names

    • 67-11-3 protein antibody
    • FLJ20565 antibody
    • Hepatocellular carcinoma-related putative tumor suppressor antibody
    • Liver-related putative tumor suppressor antibody
    • LPTL antibody
    • LPTS antibody
    • MGC8850 antibody
    • OTTHUMP00000224984 antibody
    • OTTHUMP00000224985 antibody
    • OTTHUMP00000224986 antibody
    • OTTHUMP00000225053 antibody
    • OTTHUMP00000225054 antibody
    • PIN2 interacting protein 1 antibody
    • Pin2-interacting protein X1 antibody
    • PIN2/TERF1-interacting telomerase inhibitor 1 antibody
    • PINX1 antibody
    • PINX1_HUMAN antibody
    • Protein 67-11-3 antibody
    • TRF1-interacting protein 1 antibody
    see all

Images

  • Anti-PINX1/LPTS antibody - N-terminal (ab194463) at 1/500 dilution + IMR-32 cell lysate at 50 µg

    Developed using the ECL technique.

    Predicted band size: 37 kDa

  • Anti-PINX1/LPTS antibody - N-terminal (ab194463) at 1/1000 dilution + recombinant Human PINX1 (immunogen) at 0.2 µg

    Developed using the ECL technique.

    Predicted band size: 37 kDa



    Predicted MW of immunogen: 37 KDa

References

ab194463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up