Overview

  • Product name

  • Description

    Rabbit polyclonal to PIP5K1 beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PIP5K1 beta aa 190-470.
    Sequence:

    NVLPRSMRMHFTYDLKGSTYKRRASRKEREKSNPTFKDLDFLQDMHEGLY FDTETYNALMKTLQRDCRVLESFKIMDYSLLLGIHFLDHSLKEKEEETPQ NVPDAKRTGMQKVLYSTAMESIQGPGKSGDGIITENPDTMGGIPAKSHRG EKLLLFMGIIDILQSYRLMKKLEHSWKALVYDGDTVSVHRPSFYADRFLK FMNSRVFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDL LTEGQSFSSLDEEALGSRHRPDLVPSTPSLF


    Database link: O14986

  • Positive control

    • IHC-P: Human skeletal muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Mediates RAC1-dependent reorganization of actin filaments (By similarity). Participates in the biosynthesis of phosphatidylinositol-4,5-bisphosphate.
  • Tissue specificity

    Detected in heart, pancreas, brain, kidney, skeletal muscle and lung.
  • Sequence similarities

    Contains 1 PIPK domain.
  • Cellular localization

    Endomembrane system. Associated with membranes.
  • Information by UniProt
  • Database links

  • Alternative names

    • MSS 4 antibody
    • MSS4 antibody
    • Phosphatidylinositol 4 phosphate 5 kinase type 1 beta antibody
    • Phosphatidylinositol-4-phosphate 5-kinase type I beta antibody
    • Phosphatidylinositol-4-phosphate 5-kinase type-1 beta antibody
    • PI4P5K 1 beta antibody
    • PI51B_HUMAN antibody
    • PIP5K1-beta antibody
    • PIP5K1B antibody
    • PIP5KIbeta antibody
    • Pipk 5 beta antibody
    • Pipk 5b antibody
    • Protein STM 7 antibody
    • Protein STM-7 antibody
    • PtdIns(4)P-5-kinase 1 beta antibody
    • STM 7 antibody
    • STM7 antibody
    • STM7 LSB antibody
    • Type I phosphatidylinositol 4 phosphate 5 kinase beta antibody
    • Type I phosphatidylinositol-4-phosphate 5-kinase beta antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for PIP5K1 beta using ab236114 at 1/100 dilution in immunohistochemical analysis.

References

ab236114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up