Overview

  • Product name

    Anti-PIQ antibody
  • Description

    Rabbit polyclonal to PIQ
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human PIQ aa 445-598.
    Sequence:

    RGLQELTDARRVELKKRVDDYVRRHLGSPMSDVVSRELHAQAQERLQHYF MGRALEERAQQHREALIAQISTNVEQLMKAPSLKEAEGKEPELFLSRSRP VAAKAKQAHLTTLKHIQAPWWKKLGEESGDEIDVPKDELSIELENLFIGG TKPP


    Database link: Q15051-1

  • Positive control

    • WB: Rat lung and mouse kidney tissue lysate. IHC-P: Human breast cancer and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235045 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Ubiquitously expressed in fetal and adult tissues. Localized to the outer segments and connecting cilia of photoreceptor cells.
  • Involvement in disease

    Defects in IQCB1 are the cause of Senior-Loken syndrome type 5 (SLSN5) [MIM:609254]. SLSN is a renal-retinal disorder, characterized by progressive wasting of the filtering unit of the kidney (nephronophthisis), with or without medullary cystic renal disease, and progressive eye disease. Typically this disorder becomes apparent during the first year of life.
  • Sequence similarities

    Contains 4 IQ domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • IQ calmodulin-binding motif containing 1 antibody
    • IQ calmodulin-binding motif-containing protein 1 antibody
    • IQ motif containing B1 antibody
    • Iqcb1 antibody
    • IQCB1_HUMAN antibody
    • KIAA0036 antibody
    • Nephrocystin-5 antibody
    • NPHP5 antibody
    • p53 and DNA damage-regulated IQ motif protein antibody
    • SLSN5 antibody
    see all

Images

  • All lanes : Anti-PIQ antibody (ab235045) at 1/500 dilution

    Lane 1 : Rat lung tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • Paraffin-embedded human kidney tissue stained for PIQ with ab235045 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human breast cancer tissue stained for PIQ with ab235045 at 1/100 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated ABC system.

References

ab235045 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235045.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up