Overview

  • Product name

    Anti-PISD antibody [OTI4G5]
    See all PISD primary antibodies
  • Description

    Mouse monoclonal [OTI4G5] to PISD
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow, Chinese hamster, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PISD aa 80-340. Produced in E.coli (NP_055153).
    Sequence:

    VPTRLLSRAWGRLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYR NLSEFFRRKLKPQARPVCGLHSVISPSDGRILNFGQVKNCEVEQVKGVTY SLESFLGPRMCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDY HCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKH GFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNREGV PMRKGEHLGEF


    Database link: Q9UG56-2

  • Positive control

    • WB: pCMV6-ENTRY PISD transfected HEK-293T cell lysate. IHC-P: Human colon, lung and ovary adenocarcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab236405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/150.

Perform heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120 °C for 3 minutes.

WB 1/2000. Predicted molecular weight: 47 kDa.

Target

Images

  • All lanes : Anti-PISD antibody [OTI4G5] (ab236405) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY PISD transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 47 kDa

  • Paraffin-embedded human colon tissue stained for PISD using ab236405 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lung tissue stained for PISD using ab236405 at 1/150 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for PISD using ab236405 at 1/150 dilution in immunohistochemical analysis.

References

ab236405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up