Overview

  • Product name

  • Description

    Rabbit polyclonal to PITPNC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human PITPNC1 aa 13-94.
    Sequence:

    TVDEYKIGQLYMISKHSHEQSDRGEGVEVVQNEPFEDPHHGNGQFTEKRV YLNSKLPSWARAVVPKIFYVTEKAWNYYPYTI


    Database link: Q9UKF7

  • Positive control

    • ICC/IF: PC-3 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the PtdIns transfer protein family. PI transfer class IIB subfamily.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cytoplasmic phosphatidylinositol transfer protein 1 antibody
    • M rdgB beta antibody
    • M-rdgB beta antibody
    • Mammalian rdgB homolog beta antibody
    • MrdgBbeta antibody
    • Phosphatidylinositol transfer protein cytoplasmic 1 antibody
    • PITC1_HUMAN antibody
    • pitpnc1 antibody
    • RDGB BETA antibody
    • RDGBB antibody
    • RDGBB1 antibody
    • RdgBbeta antibody
    • Retinal degeneration B beta 1 antibody
    • Retinal degeneration B homolog beta antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized PC-3 (human prostate adenocarcinoma cell line) cells stained for PITPNC1 (green) using ab222078 in ICC/IF.

References

ab222078 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222078.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up