Anti-PITPNM2 antibody (ab224057)
Key features and details
- Rat polyclonal to PITPNM2
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PITPNM2 antibody -
Description
Rat polyclonal to PITPNM2 -
Host species
Rat -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human PITPNM2 aa 360-491.
Sequence:PKDITKWSSNDLMDKIESPEPEDTQDGLYRQGAPEFRVASSVEQLNIIED EVSQPLAAPPSKIHVLLLVLHGGTILDTGAGDPSSKKGDANTIANVFDTV MRVHYPSALGRLAIRLVPCPPVCSDAFALVSN
Database link: Q9BZ72 -
Positive control
- IHC-P: Human pancreas tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab224057 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (in vitro). Binds calcium ions. -
Tissue specificity
Highly expressed in brain, heart, ovary, testis and thymus. Detected in small intestine, prostate, pancreas, skeletal muscle, liver, colon and placenta. -
Sequence similarities
Belongs to the PtdIns transfer protein family. PI transfer class IIA subfamily.
Contains 1 DDHD domain. -
Cellular localization
Endomembrane system. - Information by UniProt
-
Database links
- Entrez Gene: 57605 Human
- Omim: 608920 Human
- SwissProt: Q9BZ72 Human
- Unigene: 272759 Human
-
Alternative names
- KIAA1457 antibody
- membrane-associated 2 antibody
- Membrane-associated phosphatidylinositol transfer protein 2 antibody
see all
Images
Datasheets and documents
References (0)
ab224057 has not yet been referenced specifically in any publications.