Anti-PITX1/BFT antibody (ab244308)

Submit a review Submit a question

Overview

  • Product name

    Anti-PITX1/BFT antibody
    See all PITX1/BFT primary antibodies

  • Description

    Rabbit polyclonal to PITX1/BFT

  • Host species

    Rabbit

  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details

  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat

  • Immunogen

    Recombinant fragment corresponding to Human PITX1/BFT aa 198-294.
    Sequence:

    SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINN LTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS


    Database link: P78337

    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI

  • Positive control

    • IHC-P: Human esophagus, skin, stomach and tonsil tissue. ICC/IF: U-2 OS cells.

  • General notes

     This product was previously labelled as PITX1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab244308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb.

  • Involvement in disease

    Defects in PITX1 are a cause of congenital clubfoot (CCF) [MIM:119800]; also known as talipes equinovarus (TEV). Clubfoot is a congenital limb deformity defined as fixation of the foot in cavus, adductus, varus, and equinus (i.e. inclined inwards, axially rotated outwards, and pointing downwards) with concomitant soft tissue abnormalities. Clubfoot may occur in isolation or as part of a syndrome. Clubfoot appears to be a multifactorial trait.

  • Sequence similarities

    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.

  • Cellular localization

    Nucleus.
  • Information by UniProt

  • Database links

    see all

  • Alternative names

    • BFT antibody
    • CCF antibody
    • Hindlimb expressed homeobox protein backfoot antibody
    • Hindlimb-expressed homeobox protein backfoot antibody
    • Homeobox protein PITX1 antibody
    • LBNBG antibody
    • Paired like homeodomain 1 antibody
    • Paired like homeodomain transcription factor 1 antibody
    • Paired-like homeodomain transcription factor 1 antibody
    • Pituitary homeo box 1 antibody
    • Pituitary homeobox 1 antibody
    • Pituitary otx related factor antibody
    • Pitx1 antibody
    • PITX1_HUMAN antibody
    • POTX antibody
    • PTX1 antibody
    see all

Images

  • Immunocytochemistry/ Immunofluorescence - Anti-PITX1/BFT antibody (ab244308)
    Immunocytochemistry/ Immunofluorescence - Anti-PITX1/BFT antibody (ab244308)

    PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PITX1/BFT (green) using ab244308 at 4 µg/ml in ICC/IF.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)

    Formalin-fixed, paraffin-embedded human tonsil tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)

    Formalin-fixed, paraffin-embedded human stomach tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)

    Formalin-fixed, paraffin-embedded human skin tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)

    Formalin-fixed, paraffin-embedded human esophagus tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)

    Formalin-fixed, paraffin-embedded human pancreas tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.

    Negative control.

References

ab244308 has not yet been referenced specifically in any publications.

Publishing research using ab244308? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab244308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com