Anti-PITX1/BFT antibody (ab244308)
Key features and details
- Rabbit polyclonal to PITX1/BFT
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-PITX1/BFT antibody
See all PITX1/BFT primary antibodies -
Description
Rabbit polyclonal to PITX1/BFT -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human PITX1/BFT aa 198-294.
Sequence:SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINN LTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS
Database link: P78337 -
Positive control
- IHC-P: Human esophagus, skin, stomach and tonsil tissue. ICC/IF: U-2 OS cells.
-
General notes
This product was previously labelled as PITX1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: PBS, 40% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab244308 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
May play a role in the development of anterior structures, and in particular, the brain and facies and in specifying the identity or structure of hindlimb. -
Involvement in disease
Defects in PITX1 are a cause of congenital clubfoot (CCF) [MIM:119800]; also known as talipes equinovarus (TEV). Clubfoot is a congenital limb deformity defined as fixation of the foot in cavus, adductus, varus, and equinus (i.e. inclined inwards, axially rotated outwards, and pointing downwards) with concomitant soft tissue abnormalities. Clubfoot may occur in isolation or as part of a syndrome. Clubfoot appears to be a multifactorial trait. -
Sequence similarities
Belongs to the paired homeobox family. Bicoid subfamily.
Contains 1 homeobox DNA-binding domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 5307 Human
- Entrez Gene: 18740 Mouse
- Entrez Gene: 113983 Rat
- Omim: 602149 Human
- SwissProt: P78337 Human
- SwissProt: P70314 Mouse
- SwissProt: Q99NA7 Rat
- Unigene: 84136 Human
see all -
Alternative names
- BFT antibody
- CCF antibody
- Hindlimb expressed homeobox protein backfoot antibody
see all
Images
-
PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for PITX1/BFT (green) using ab244308 at 4 µg/ml in ICC/IF.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
Formalin-fixed, paraffin-embedded human tonsil tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
Formalin-fixed, paraffin-embedded human stomach tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
Formalin-fixed, paraffin-embedded human skin tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
Formalin-fixed, paraffin-embedded human esophagus tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PITX1/BFT antibody (ab244308)
Formalin-fixed, paraffin-embedded human pancreas tissue stained for PITX1/BFT using ab244308 at 1/20 dilution in immunohistochemical analysis.
Negative control.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab244308 has not yet been referenced specifically in any publications.