For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    piwil3-antibody-ab93709.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Stem Cells Germline Stem Cells Embryonic Germ Cells
Share by email

Anti-PIWIL3 antibody (ab93709)

  • Datasheet
Submit a review Q&A (1)References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PIWIL3 antibody (ab93709)

    Key features and details

    • Rabbit polyclonal to PIWIL3
    • Suitable for: IHC-P
    • Reacts with: Human
    • Isotype: IgG

    You may also be interested in

    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-PIWIL3 antibody
      See all PIWIL3 primary antibodies
    • Description

      Rabbit polyclonal to PIWIL3
    • Host species

      Rabbit
    • Tested Applications & Species

      Application Species
      IHC-P
      Human
      See all applications and species data
    • Immunogen

      Synthetic peptide corresponding to Human PIWIL3 (internal sequence).
      Database link: NM_001008496

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at -20°C. Stable for 12 months at -20°C.
    • Storage buffer

      pH: 7.40
      Preservative: 0.02% Sodium azide
      Constituent: PBS
    • Concentration information loading...
    • Purity

      Protein A purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Stem Cells
      • Germline Stem Cells
      • Embryonic Germ Cells
      • Epigenetics and Nuclear Signaling
      • RNAi
      • Argonaute and Piwi
      • Developmental Biology
      • Reproduction
      • Germ cell markers
      • Epigenetics and Nuclear Signaling
      • Nuclear Signaling Pathways
      • Nuclear Receptors
      • Nuclear Pore Complex

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)

    Applications

    The Abpromise guarantee

    Our Abpromise guarantee covers the use of ab93709 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Guaranteed

    Tested applications are guaranteed to work and covered by our Abpromise guarantee.

    Predicted

    Predicted to work for this combination of applications and species but not guaranteed.

    Incompatible

    Does not work for this combination of applications and species.

    Application Species
    IHC-P
    Human
    Application Abreviews Notes
    IHC-P
    1/100 - 1/500.
    Notes
    IHC-P
    1/100 - 1/500.

    Target

    • Function

      May play a role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Besides their function in transposable elements repression, piRNAs are probably involved in other processes during meiosis such as translation regulation.
    • Tissue specificity

      Expressed in testis.
    • Sequence similarities

      Belongs to the argonaute family. Piwi subfamily.
      Contains 1 PAZ domain.
      Contains 1 Piwi domain.
    • Cellular localization

      Cytoplasm. Probable component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon during meiosis.
    • Target information above from: UniProt accession Q7Z3Z3 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 440822 Human
      • Omim: 610314 Human
      • SwissProt: Q7Z3Z3 Human
      • Unigene: 448343 Human
      • Alternative names

        • HIWI3 antibody
        • Piwi like 3 antibody
        • Piwi-like protein 3 antibody
        • piwi-like RNA-mediated gene silencing 3 antibody
        • PIWIL3 antibody
        • PIWL3_HUMAN antibody
        see all

      Images

      • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PIWIL3 antibody (ab93709)
        Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-PIWIL3 antibody (ab93709)
        ab93709, at 1/100 dilution, staining PIWIL3 in formalin-fixed, paraffin-embedded Human testis tissue by Immunohistochemistry.

      Protocols

      • Immunohistochemistry protocols

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (1)

      Publishing research using ab93709? Please let us know so that we can cite the reference in this datasheet.

      ab93709 has been referenced in 1 publication.

      • Cao J  et al. High expression of piwi-like RNA-mediated gene silencing 1 is associated with poor prognosis via regulating transforming growth factor-ß receptors and cyclin-dependent kinases in breast cancer. Mol Med Rep 13:2829-35 (2016). PubMed: 26847393

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      Question

      LS,
      Could you please let me know the aa-sequence of the peptide against which Anti-PIWIL3 antibody (ab93709) is raised?
      Best regards.

      Read More

      Abcam community

      Verified customer

      Asked on Apr 16 2012

      Answer

      Thank you for contacting us.

      I can confirm that the immunogen for ab93709 is a peptide located between amino acids 500 and 600of human PIWIL3(SwissProtID Q7Z3Z3):

      PLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVDGDANSYIDTLRKYTRPTLQMGMSCLLVFKVICILPNDDKRRYDSIKRYLCT

      I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

      Read More

      Abcam Scientific Support

      Answered on Apr 16 2012

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.