Overview

  • Product name

    Anti-PKA alpha + beta (catalytic subunits) antibody
    See all PKA alpha + beta (catalytic subunits) primary antibodies
  • Description

    Rabbit polyclonal to PKA alpha + beta (catalytic subunits)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Synthetic peptide within Cow PKA alpha + beta (catalytic subunits) aa 5-55 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    ATAKKGSEVESVKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGS F


    Database link: P05131

  • Positive control

    • Human lung carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500.
IHC-P 1/100 - 1/500.

Target

  • Relevance

    PRKACA and PRKACB are members of the Ser/Thr protein kinase family and are a catalytic subunit of cAMP-dependent protein kinase. cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits.
  • Cellular localization

    Cytoplasm. Nucleus. Note=Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm
  • Database links

  • Alternative names

    • cAMP dependent protein kinase beta catalytic subunit antibody
    • cAMP dependent protein kinase alpha catalytic subunit antibody
    • cAMP dependent protein kinase catalytic subunit alpha antibody
    • cAMP dependent protein kinase catalytic subunit beta antibody
    • PKA C alpha antibody
    • PKA C beta antibody
    • PKACA antibody
    • PKACB antibody
    • PRKACA antibody
    • PRKACB antibody
    • Protein kinase cAMP dependent catalytic alpha antibody
    • Protein kinase cAMP dependent catalytic beta antibody
    see all

Images

  • Anti-PKA alpha + beta (catalytic subunits) antibody (ab216572) at 1/500 dilution + Jurkat lysates

    Secondary
    Conjugated secondary antibody at 1/10000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human lung carcinoma tissue labeling cAMP Protein Kinase Catalytic subunit with ab216572 at 1/200 dilution, followed by secondary antibody detection and DAB staining.

References

ab216572 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up