Overview

  • Product name

  • Description

    Rabbit polyclonal to PKA R2/PKR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PKA R2/PKR2 aa 43-205.
    Sequence:

    ARAPASVLPAATPRQSLGHPPPEPGPDRVADAKGDSESEEDEDLEVPVPS RFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLFKN LDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDN QTRSVGQYDNRGS


    Database link: P13861

  • Positive control

    • WB: HeLa, MCF7 and PC-3 whole cell lysates. IHC-P: Human lymph node and glioma tissue. ICC/IF: HepG2 cells.
  • General notes

     This product was previously labelled as PKA R2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 46 kDa.
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
  • Tissue specificity

    Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
  • Sequence similarities

    Belongs to the cAMP-dependent kinase regulatory chain family.
    Contains 2 cyclic nucleotide-binding domains.
  • Post-translational
    modifications

    Phosphorylated by the activated catalytic chain.
  • Cellular localization

    Cytoplasm. Cell membrane. Colocalizes with PJA2 in the cytoplasm and the cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • cAMP dependent protein kinase regulatory subunit alpha 2 antibody
    • cAMP dependent protein kinase regulatory subunit RII alpha antibody
    • cAMP dependent protein kinase type II alpha regulatory chain antibody
    • cAMP dependent protein kinase type II alpha regulatory subunit antibody
    • cAMP-dependent protein kinase type II-alpha regulatory subunit antibody
    • KAP2 antibody
    • KAP2_HUMAN antibody
    • MGC3606 antibody
    • PKR 2 antibody
    • PKR2 antibody
    • PRKA R2 antibody
    • PRKAR 2 antibody
    • PRKAR2 antibody
    • PRKAR2A antibody
    • Protein kinase A RII alpha subunit antibody
    • Protein kinase cAMP dependent regulatory type II alpha antibody
    see all

Images

  • All lanes : Anti-PKA R2/PKR2 antibody (ab236855) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : PC-3 (human prostate adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 46 kDa

  • Paraffin-embedded human lymph node tissue stained for PKA R2/PKR2 using ab236855 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human glioma tissue stained for PKA R2/PKR2 using ab236855 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for PKA R2/PKR2 (green) using ab236855 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-congugated Goat Anti-Rabbit IgG (H+L).

References

ab236855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up