Overview

  • Product name

  • Description

    Rabbit polyclonal to PKC epsilon
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Rabbit
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PKC epsilon aa 403-672. (Expressed in E.coli).
    Sequence:

    LGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDC TMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSR KFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFG MCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMA GQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGC VASQNGEDAIKQHPFFKEID


    Database link: Q02156

  • Positive control

    • WB: Recombinant human PKC epsilon; Mouse and pig brain lysates; HeLa cell lysate. IHC-P: Human liver, kidney, rectum and thyroid cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab233292 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 84 kDa.

Target

  • Function

    This is calcium-independent, phospholipid-dependent, serine- and threonine-specific enzyme.
    PKC is activated by diacylglycerol which in turn phosphorylates a range of cellular proteins. PKC also serves as the receptor for phorbol esters, a class of tumor promoters.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 C2 domain.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
    Contains 1 protein kinase domain.
  • Domain

    The C1 domain, containing the phorbol ester/DAG-type region 1 (C1A) and 2 (C1B), is the diacylglycerol sensor and the C2 domain is a non-calcium binding domain.
  • Post-translational
    modifications

    Phosphorylation on Thr-566 by PDPK1 triggers autophosphorylation on Ser-729.
  • Information by UniProt
  • Database links

  • Alternative names

    • KPCE_HUMAN antibody
    • MGC125656 antibody
    • MGC125657 antibody
    • nPKC epsilon antibody
    • nPKC-epsilon antibody
    • PKCE antibody
    • Pkcea antibody
    • PRKCE antibody
    • Protein kinase C epsilon antibody
    • Protein kinase C epsilon type antibody
    see all

Images

  • Paraffin-embedded human liver tissue stained for PKC epsilon using ab233292 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for PKC epsilon using ab233292 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human rectum tissue stained for PKC epsilon using ab233292 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human thyroid cancer tissue stained for PKC epsilon using ab233292 at 20μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PKC epsilon antibody (ab233292) at 3 µg/ml + Recombinant human PKC epsilon protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

  • All lanes : Anti-PKC epsilon antibody (ab233292) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : Pig brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 84 kDa

References

ab233292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up