Overview

  • Product name

  • Description

    Mouse polyclonal to PKC mu/PKD
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human PKC mu/PKD aa 1-912. NCBI: AAI60015.1
    Sequence:

    MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGIS FHLQIGLSREPVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDK ILLFRHDPTSENILQLVKAASDIQEGDLIEVVLSASATFEDFQIRPHALF VHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVR RRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQ SYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDS ERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPST SNNIPLMRVVQSVKHTKRKSSTVMKEGWMVHYTSKDTLRKRHYWRLDSKC ITLFQNDTGSRYYKEIPLSEILSLEPVKTSALIPNGANPHCFEITTANVV YYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHALMPVIPKGSSV GTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFE TPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFK NIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYL APEVLRNKGYNRSLDMWSVGVIIYVSLSGTFPFNEDEDIHDQIQNAAFMY PPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQDYQTWLDLRE LECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET EMKALGERVSIL


    Database link: Q15139

  • Positive control

    • Lysate from 293T cells transfected with PKC mu/PKD.
  • General notes

     This product was previously labelled as PKC mu

     

Properties

Applications

Our Abpromise guarantee covers the use of ab172096 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 102 kDa.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • Function

    Converts transient diacylglycerol (DAG) signals into prolonged physiological effects, downstream of PKC. Involved in resistance to oxidative stress through activation of NF-kappa-B.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. PKD subfamily.
    Contains 1 PH domain.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
    Contains 1 protein kinase domain.
  • Cellular localization

    Cytoplasm. Membrane. Translocation to the cell membrane is required for kinase activation.
  • Information by UniProt
  • Database links

  • Alternative names

    • KPCD1_HUMAN antibody
    • nPKC D1 antibody
    • nPKC mu antibody
    • nPKC-D1 antibody
    • nPKC-mu antibody
    • nPKCD1 antibody
    • nPKCmu antibody
    • PKC antibody
    • PKC MU antibody
    • PKCM antibody
    • PKCmu antibody
    • PKD 1 antibody
    • PKD antibody
    • PKD1 antibody
    • PRKCM antibody
    • PRKD 1 antibody
    • Prkd1 antibody
    • Protein kinase C mu antibody
    • Protein kinase C mu type antibody
    • Protein kinase D antibody
    • Protein kinase D1 antibody
    • Serine/threonine protein kinase D1 antibody
    • Serine/threonine-protein kinase D1 antibody
    see all

Images

  • Immunofluorescence of ab172096 on HeLa cell. [antibody concentration 10 ug/ml]

  • All lanes : Anti-PKC mu/PKD antibody (ab172096) at 1 µg/ml

    Lane 1 : Lysate from 293T cells transfected with PKC mu/PKD
    Lane 2 : Lysate from untransfected 293T cells

    Lysates/proteins at 15 µl per lane.

    Predicted band size: 102 kDa

References

ab172096 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

Application
Western blot
Sample
Rat Cell lysate - whole cell (Astrocytes)
Gel Running Conditions
Reduced Denaturing (8%)
Loading amount
20 µg
Treatment
Control, Insulin 10nM, IGF-1nM or both hormones 10nM for 15 minutes
Specification
Astrocytes
Blocking step
Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Mr. Edwin Hernandez

Verified customer

Submitted May 30 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up