Overview

  • Product name

    Anti-PKD1L3 antibody
  • Description

    Rabbit polyclonal to PKD1L3
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PKD1L3 aa 22-194.
    Sequence:

    ELNSPAPHGQNNCYQLNRFQCSFEEAQHYCHVQRGFLAHIWNKEVQDLIR DYLEEGKKWWIGQNVMPLKKHQDNKYPADVAANGPPKPLSCTYLSRNFIR ISSKGDKCLLKYYFICQTGDFLDGDAHYERNGNNSHLYQRHKKTKRGVAI ARDKMPPGPGHLPTTCHYPLPAH


    Database link: Q7Z443

  • Positive control

    • IHC-P: Human placenta and heart tissue. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    PKD1L3 belongs to the polycystin family. It may function as an ion-channel regulator and may function with PKD2L1 as heteromeric taste channels.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • PC1 like 3 protein antibody
    • Polycystic kidney disease 1 like 3 antibody
    • Polycystic kidney disease protein 1 like 3 antibody
    • Polycystin 1 like 3 antibody
    • Polycystin 1L3 antibody
    see all

Images

  • A549 (Human lung carcinoma cell line) cells stained for PKD1L3 using ab234670 at a dilution of 1/100 in ICC/IF. Secondary antibody is an Alexa Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human heart tissue stained for PKD1L3 with ab234670 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for PKD1L3 with ab234670 1/100 dilution in immunohistochemical analysis.

References

ab234670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up