Overview

  • Product name

  • Description

    Rabbit polyclonal to PKIB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PKIB aa 8-76. Two N-terminal tags, (Expressed in E.coli).
    Sequence:

    MTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKED AKEKDEKTTQDQLEKPQNE


    Database link: Q9C010

  • Positive control

    • WB: Human placenta; Recombinant human PKIB protein. IHC-P: Human prostate, pancreatic cancer, stomach cancer and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab233521 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
  • Sequence similarities

    Belongs to the PKI family.
  • Information by UniProt
  • Database links

  • Alternative names

    • cAMP dependent protein kinase inhibitor 2 antibody
    • cAMP-dependent protein kinase inhibitor beta antibody
    • FLJ23817 antibody
    • IPKB_HUMAN antibody
    • OTTHUMP00000017115 antibody
    • OTTHUMP00000017116 antibody
    • OTTHUMP00000017117 antibody
    • PKI-beta antibody
    • PKIB antibody
    • PRKACN2 antibody
    • Protein kinase (cAMP dependent, catalytic) inhibitor beta antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for PKIB using ab233521 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach cancer tissue stained for PKIB using ab233521 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human pancreatic cancer tissue stained for PKIB using ab233521 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PKIB using ab233521 at 10 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PKIB antibody (ab233521) at 3 µg/ml + Human placenta tissue lysate

    Secondary
    HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution
  • Anti-PKIB antibody (ab233521) at 5 µg/ml + Recombinant human PKIB protein

References

ab233521 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233521.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up