Overview

  • Product name

    Anti-PKMYT1 antibody [OTI1C3]
    See all PKMYT1 primary antibodies
  • Description

    Mouse monoclonal [OTI1C3] to PKMYT1
  • Host species

    Mouse
  • Tested applications

    Suitable for: Flow Cyt, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Dog, Human
  • Immunogen

    Recombinant full length protein corresponding to Human PKMYT1 aa 1-499. Produced in HEK-293T cells (NP_004194).
    Sequence:

    MLERPPALAMPMPTEGTPPPLSGTPIPVPAYFRHAEPGFSLKRPRGLSRS LPPPPPAKGSIPISRLFPPRTPGWHQLQPRRVSFRGEASETLQSPGYDPS RPESFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKD RARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQHCEA WGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGRCKLG DFGLLVELGTAGAGEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVA CNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLVMMLEPDPKLRATA EALLALPVLRQPRAWGVLWCMAAEALSRGWALWQALLALLCWLWHGLAHP ASWLQPLGPPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLARTV GSTSTPRSRCTPRDALDLSDINSEPPRGSFPSFEPRNLLSLFEDTLDPT


    Database link: Q99640

  • Positive control

    • ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY PKMYT1. WB: HEK-293T cell lysate transfected with pCMV6-ENTRY PKMYT1 cDNA; MDCK and PC-12 cell extracts. Flow Cyt: HeLa cells.
  • General notes

    Clone OTI1C3 (formerly 1C3).

Properties

Applications

Our Abpromise guarantee covers the use of ab117946 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt 1/100.
WB 1/500 - 1/2000. Predicted molecular weight: 55 kDa.
ICC/IF 1/100.

Target

  • Function

    Acts as a negative regulator of entry into mitosis (G2 to M transition) by phosphorylation of the CDK1 kinase specifically when CDK1 is complexed to cyclins. Mediates phosphorylation of CDK1 predominantly on 'Thr-14'. Also involved in Golgi fragmentation. May be involved in phosphorylation of CDK1 on 'Tyr-15' to a lesser degree, however tyrosine kinase activity is unclear and may be indirect. May be a downstream target of Notch signaling pathway during eye development.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. WEE1 subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The membrane-association motif is essential for the localization to membrane of Golgi stack. According to some authors, it is a transmembrane domain; the existence of a transmembrane region is however unproven.
  • Post-translational
    modifications

    Autophosphorylated. Phosphorylated by CDC2-CCNB1 complexes on undefined serine and threonine residues. The phosphorylation by CDC2-CCNB1 complexes may inhibit the catalytic activity.
  • Cellular localization

    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • cdc2 inhibitory kinase antibody
    • DKFZp547K1610 antibody
    • FLJ20093 antibody
    • Membrane associated tyrosine and threonine specific cdc2 inhibitory kinase antibody
    • Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase antibody
    • MYT1 antibody
    • Myt1 kinase antibody
    • PKMYT 1 antibody
    • Pkmyt1 antibody
    • PMYT1_HUMAN antibody
    • PPP1R126 antibody
    • Protein kinase membrane associated tyrosine/threonine 1 antibody
    • Protein kinase Myt1 antibody
    • Protein phosphatase 1 regulatory subunit 126 antibody
    see all

Images

  • All lanes : Anti-PKMYT1 antibody [OTI1C3] (ab117946) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA for 48 hrs
    Lane 2 : HEK-293T cell lysate transfected with the pCMV6-ENTRY PKMYT1 cDNA for 48 hrs

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 55 kDa

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY PKMYT1, stained for PKMYT1 (green) using ab117946 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling PKMYT1 using ab117946 (red) at 1/100 dilution, compared to a nonspecific negative control (blue).

  • All lanes : Anti-PKMYT1 antibody [OTI1C3] (ab117946) at 1/200 dilution

    Lane 1 : MDCK (canine kidney cell line) cell extract
    Lane 2 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 55 kDa

References

ab117946 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117946.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up