Overview

  • Product name

  • Description

    Rabbit polyclonal to PKN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human PKN2 aa 925-969.
    Sequence:

    MDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEE


    Database link: Q16513-1

  • Positive control

    • IHC-P: Human colon cancer tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238334 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Exhibits a preference for highly basic protein substrates.
  • Sequence similarities

    Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily.
    Contains 1 AGC-kinase C-terminal domain.
    Contains 1 C2 domain.
    Contains 1 protein kinase domain.
    Contains 3 REM (Hr1) repeats.
  • Domain

    The C1 domain does not bind the diacylglycerol (DAG).
  • Post-translational
    modifications

    Autophosphorylated.
    Activated by limited proteolysis with trypsin.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cardiolipin activated protein kinase Pak2 antibody
    • MGC150606 antibody
    • MGC71074 antibody
    • PAK 2 antibody
    • PAK2 antibody
    • PKN gamma antibody
    • PKN2 antibody
    • PKN2_HUMAN antibody
    • PRK2 antibody
    • PRKCL2 antibody
    • PRO2042 antibody
    • Protein kinase C like 2 antibody
    • Protein kinase C related kinase 2 antibody
    • Protein kinase C-like 2 antibody
    • Protein kinase N2 antibody
    • Protein-kinase C-related kinase 2 antibody
    • Serine/threonine-protein kinase N2 antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for PKN2 using ab238334 at a dilution of 1/100 in ICC/IF. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L).

  • Paraffin-embedded human colon cancer tissue stained for PKN2 with ab238334 at a 1/100 dilution in immunohistochemical analysis.

References

ab238334 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238334.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up