Overview

  • Product name

  • Description

    Rabbit polyclonal to PLA1A/NMD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human PLA1A/NMD aa 309-452. (Expressed in E.coli).
    Sequence:

    LVEQGGVKIEPLPKEVKVYLLTTSSAPYCMHHSLVEFHLKELRNKDTNIE VTFLSSNITSSSKITIPKQQRYGKGIIAHATPQCQINQVKFKFQSSNRVW KKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLK


    Database link: Q53H76

  • Positive control

    • WB: HEK-293T cell lysate; Pig liver lysate; Recombinant human PLA1A/NMD protein. IHC-P: Human lung and kidney tissues.
  • General notes

     This product was previously labelled as PLA1A

     

Properties

Applications

Our Abpromise guarantee covers the use of ab233145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 50 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Hydrolyzes the ester bond at the sn-1 position of glycerophospholipids and produces 2-acyl lysophospholipids. Hydrolyzes phosphatidylserine (PS) in the form of liposomes and 1-acyl-2 lysophosphatidylserine (lyso-PS), but not triolein, phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidic acid (PA) or phosphatidylinositol (PI). Isoform 2 hydrolyzes lyso-PS but not PS. Hydrolysis of lyso-PS in peritoneal mast cells activated by receptors for IgE leads to stimulate histamine production.
  • Tissue specificity

    Widely expressed. Expressed in placenta, prostate and liver. Weakly or not expressed in skin, leukocytes, platelets, colon, spleen, lung, muscle and kidney.
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • AA986889 antibody
    • NMD antibody
    • OTTHUMP00000215248 antibody
    • OTTHUMP00000215249 antibody
    • OTTHUMP00000215250 antibody
    • Phosphatidylserine specific phospholipase A1 antibody
    • Phosphatidylserine specific phospholipase A1alpha antibody
    • Phosphatidylserine-specific phospholipase A1 antibody
    • Phospholipase A1 member A antibody
    • pla1a antibody
    • PLA1A_HUMAN antibody
    • PS PLA1 antibody
    • PS-PLA1 antibody
    • PSPLA 1 antibody
    • PSPLA1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human lung tissue stained for PLA1A/NMD using ab233145 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for PLA1A/NMD using ab233145 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • All lanes : Anti-PLA1A/NMD antibody (ab233145) at 1.5 µg/ml

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : Pig liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/1000 dilution

    Predicted band size: 50 kDa

  • Anti-PLA1A/NMD antibody (ab233145) at 2 µg/ml + Recombinant human PLA1A/NMD protein

    Predicted band size: 50 kDa

References

ab233145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up