Overview

  • Product name

  • Description

    Rabbit polyclonal to PLA2G4E
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human PLA2G4E aa 684-774.
    Sequence:

    LCLLDTAFFVNSSYPPLLRPERKADLIIHLNYCAGSQTKPLKQTCEYCTV QNIPFPKYELPDENENLKECYLMENPQEPDAPIVTFFPLIN


    Database link: Q3MJ16

  • Positive control

    • Human oral mucosa; Human skin tissue and Human skin cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab188438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    PLA2G4E is a calcium-dependent phospholipase A2 that selectively hydrolyzes glycerophospholipids in the sn-2 position.
  • Cellular localization

    Cytoplasm, cytosol. Lysosome membrane, Peripheral membrane protein.
  • Database links

  • Alternative names

    • MGC126633 antibody
    • cPLA2 epsilon antibody
    • Cytosolic phospholipase A2 epsilon antibody
    • FLJ45651 antibody
    • MGC126661 antibody
    • Phospholipase A2 group IVE antibody
    • PLA2G4E antibody
    see all

Images

  • Immunohistochemical staining of Human skin labeling PLA2G4E using ab188438 at 1/1000 dilution.

  • Immunohistochemical staining of Human skin cancer tissue labeling PLA2G4E using ab188438 at 1/1000 dilution.

  • Immunohistochemical staining of Human oral mucosa labeling PLA2G4E using ab188438 at 1/1000 dilution.

References

ab188438 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Abreviews
Application
Western blot
Sample
Human Cell lysate - whole cell (U2OS Human Osteosarcoma Cells)
Gel Running Conditions
Reduced Denaturing (10% gel)
Loading amount
20 µg
Specification
U2OS Human Osteosarcoma Cells
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Leanne Lu

Verified customer

Submitted May 16 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up