Overview

  • Product name

    Anti-PLA2G7 antibody [089171]
    See all PLA2G7 primary antibodies
  • Description

    Mouse monoclonal [089171] to PLA2G7
  • Host species

    Mouse
  • Specificity

    Specific for PLA2G7 denatured and native forms.
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human PLA2G7 aa 49-441.
    Sequence:

    ASFGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWI PNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVV FSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEI GDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNA LDLKFDMEQLKDSIDREKIAVIGHSFGGATVIQTLSEDQRFRCGIALDAW MFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRG SVHQNFADFTFATGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGL HKDFDQWDCLIEGDDENLIPGTNINTTNQHIMLQNSSGIEKYN


    Database link: Q13093

  • Positive control

    • WB: Mouse spleen tissue lysate. IHC-P: Human colon cancer, breast cancer and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Detects a band of approximately 44 kDa (predicted molecular weight: 50 kDa).
IHC-P 1/50 - 1/500.

Target

  • Function

    Modulates the action of platelet-activating factor (PAF) by hydrolyzing the sn-2 ester bond to yield the biologically inactive lyso-PAF. Has a specificity for substrates with a short residue at the sn-2 position. It is inactive against long-chain phospholipids.
  • Tissue specificity

    Plasma.
  • Involvement in disease

    Platelet-activating factor acetylhydrolase deficiency
    Asthma
    Atopic hypersensitivity
  • Sequence similarities

    Belongs to the AB hydrolase superfamily. Lipase family.
  • Cellular localization

    Secreted, extracellular space.
  • Information by UniProt
  • Database links

  • Alternative names

    • Platelet-activating factor acetylhydrolase precursor antibody
    • 1 alkyl 2 acetylglycerophosphocholine esterase antibody
    • 1-alkyl-2-acetylglycerophosphocholine esterase antibody
    • 2 acetyl 1 alkylglycerophosphocholine esterase antibody
    • 2-acetyl-1-alkylglycerophosphocholine esterase antibody
    • EC 3.1.1.47 PAF acetylhydrolase PAF 2-acylhydrolase LDL associated phospholipase A2 antibody
    • Group VIIA phospholipase A2 antibody
    • Group-VIIA phospholipase A2 antibody
    • gVIIA PLA2 antibody
    • gVIIA-PLA2 antibody
    • LDL associated phospholipase A2 antibody
    • LDL PLA(2) antibody
    • LDL PLA2 antibody
    • LDL-associated phospholipase A2 antibody
    • LDL-PLA(2) antibody
    • Lipoprotein associated phospholipase A2 antibody
    • LP PLA2 antibody
    • PAF 2 acylhydrolase antibody
    • PAF 2 acylhydrolase LDL associated phospholipase A2 antibody
    • PAF 2-acylhydrolase antibody
    • PAF acetylhydrolase antibody
    • PAFA_HUMAN antibody
    • PAFAD antibody
    • PAFAH antibody
    • Phospholipase A2, group VII (platelet activating factor acetylhydrolase, plasma) antibody
    • PLA2G7 antibody
    • Platelet activating factor acetylhydrolase 2 antibody
    • Platelet activating factor acetylhydrolase antibody
    • Platelet-activating factor acetylhydrolase antibody
    see all

Images

  • Anti-PLA2G7 antibody [089171] (ab234703) at 1/500 dilution + Mouse spleen tissue lysate

    Secondary
    HRP labeled Goat polyclonal to Mouse IgG at 1/3000 dilution

    Predicted band size: 50 kDa
    Observed band size: 44,85 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human colon cancer tissue stained for PLA2G7 using ab234703 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human breast cancer tissue stained for PLA2G7 using ab234703 at 1/200 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for PLA2G7 using ab234703 at 1/200 dilution in immunohistochemical analysis.

References

ab234703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up