Anti-PLA2R antibody [CL0474] (ab188028)

Mouse monoclonal PLA2R antibody [CL0474]. Validated in WB, IHC and tested in Human. Cited in 1 publication(s). Immunogen corresponding to recombinant fragment.

Overview

  • Product name

    Anti-PLA2R antibody [CL0474]
    See all PLA2R primary antibodies
  • Description

    Mouse monoclonal [CL0474] to PLA2R
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PLA2R aa 395-530.
    Sequence:

    EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSN KIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCE ERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID


    Database link: Q13018

  • Epitope

    Binds to an epitope located within the peptide sequence KIPVSFEWSN as determined by overlapping synthetic peptides.
  • Positive control

    • PLA2R transfected HEK293T lysate; Human kidney, cortex and cerebellum tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab188028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 169 kDa.

Target

  • Function

    Receptor for secretory phospholipase A2 (sPLA2). Acts as a receptor for phosholipase sPLA2-IB/PLA2G1B but not sPLA2-IIA/PLA2G2A. Also able to bind to snake PA2-like toxins. Although its precise function remains unclear, binding of sPLA2 to its receptor participates in both positive and negative regulation of sPLA2 functions as well as clearance of sPLA2. Binding of sPLA2-IB/PLA2G1B induces various effects depending on the cell type, such as activation of the mitogen-activated protein kinase (MAPK) cascade to induce cell proliferation, the production of lipid mediators, selective release of arachidonic acid in bone marrow-derived mast cells. In neutrophils, binding of sPLA2-IB/PLA2G1B can activate p38 MAPK to stimulate elastase release and cell adhesion. May be involved in responses in proinflammatory cytokine productions during endotoxic shock. Also has endocytic properties and rapidly internalizes sPLA2 ligands, which is particularly important for the clearance of extracellular sPLA2s to protect their potent enzymatic activities. The soluble secretory phospholipase A2 receptor form is circulating and acts as a negative regulator of sPLA2 functions by blocking the biological functions of sPLA2-IB/PLA2G1B.
  • Tissue specificity

    Present in lung macrophage (at protein level). Highly expressed in kidney. Also expressed in pancreas, amnion, choriodecidua and placenta. Isoform 2 is expressed at much lower level.
  • Sequence similarities

    Contains 8 C-type lectin domains.
    Contains 1 fibronectin type-II domain.
    Contains 1 ricin B-type lectin domain.
  • Domain

    C-type lectin domains 3-5 mediate the interaction with phospholipase PLA2G1B.
    The endocytosis signal probably mediates endocytosis via clathrin-coated pits.
  • Post-translational
    modifications

    The secretory phospholipase A2 receptor form may be produced by the action of metalloproteinases. It contains all extracellular domains and only lacks transmembrane and cytosolic regions. It is however unclear whether this form is produced by proteolytic cleavage as suggested by some experiments, or by alternative splicing, as in the case of isoform 2 that shares all characteristics of secretory phospholipase A2 receptor form.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 180 kDa secretory phospholipase A2 receptor antibody
    • C-type lectin domain family 13 member C antibody
    • CLEC13C antibody
    • M type receptor antibody
    • M-type receptor antibody
    • Phospholipase A2 receptor 1 antibody
    • PLA2 R antibody
    • PLA2-R antibody
    • PLA2G1R antibody
    • PLA2IR antibody
    • PLA2R antibody
    • PLA2R_HUMAN antibody
    • PLA2R1 antibody
    • Soluble PLA2-R antibody
    • Soluble PLA2R antibody
    • Soluble secretory phospholipase A2 receptor antibody
    see all

Images

  • All lanes : Anti-PLA2R antibody [CL0474] (ab188028) at 1/500 dilution

    Lane 1 : Vector only transfected HEK293T cell lysate
    Lane 2 : PLA2R transfected HEK293T cell lysate with a C-terminal myc-DDK tag

    Predicted band size: 169 kDa

  • Immunohistochemical staining (using ab188028) of human kidney with membranous nephropathy shows strong membranous immunoreactivity in renal glomeruli.

  • Immunohistochemical staining (using ab188028) of human kidney shows only low background positivity.

  • Immunohistochemical analysis of Paraffin-embedded Human cortex tissue labeling PLA2R with ab188028 at 1/500 dilution.

  • Immunohistochemical analysis of Paraffin-embedded Human cerebellum tissue labeling PLA2R with ab188028 at 1/500 dilution.

References

This product has been referenced in:

  • Cong R  et al. MicroRNA-218 promotes prostaglandin E2 to inhibit osteogenic differentiation in synovial mesenchymal stem cells by targeting 15-hydroxyprostaglandin dehydrogenase [NAD(+)]. Mol Med Rep 16:9347-9354 (2017). Read more (PubMed: 29039590) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up