Overview

  • Product name

  • Description

    Rabbit polyclonal to PLAC8
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PLAC8 aa 1-110.
    Sequence:

    MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCL GCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLC QIKRDINRRR


    Database link: Q9NZF1

  • Positive control

    • IHC-P: Human tonsil and spleen tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Expressed at high levels in plasmacytoid dendritic cells. High expression in spleen, lymph nodes, peripheral blood leukocytes, and bone marrow, with lower expression in thymus, appendix, and fetal liver.
  • Sequence similarities

    Belongs to the cornifelin family.
  • Information by UniProt
  • Database links

  • Alternative names

    • C15 antibody
    • Onzin antibody
    • PLAC8 antibody
    • PLAC8_HUMAN antibody
    • Placenta specific 8 antibody
    • Placenta-specific gene 8 protein antibody
    • Protein C15 antibody
    see all

Images

  • Paraffin-embedded human tonsil tissue stained for PLAC8 using ab234788 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human spleen tissue stained for PLAC8 using ab234788 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for PLAC8 using ab234788 at 1/100 dilution in immunofluorescent analysis. Secondary antibody was Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab234788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up