Overview

  • Product name

    Anti-Placental alkaline phosphatase (PLAP) antibody
    See all Placental alkaline phosphatase (PLAP) primary antibodies
  • Description

    Rabbit polyclonal to Placental alkaline phosphatase (PLAP)
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Placental alkaline phosphatase (PLAP) aa 189-218.
    Sequence:

    NWYSDADVPASARQEGCQDIATQLISNMDI


    Database link: P05187

  • Positive control

    • IHC-P: Human placenta tissue. WB: Human placenta tissue lysate. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243731 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 58 kDa.

Target

  • Sequence similarities

    Belongs to the alkaline phosphatase family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alkaline phosphatase antibody
    • Alkaline phosphatase placental antibody
    • Alkaline phosphatase placental type antibody
    • Alkaline phosphatase Regan isozyme antibody
    • ALP antibody
    • Alp1 antibody
    • ALPP antibody
    • FLJ61142 antibody
    • Germ-cell alkaline phosphatase antibody
    • nagao isozyme antibody
    • OTTHUMP00000164354 antibody
    • PALP antibody
    • Placental alkaline phosphatase 1 antibody
    • placental heat-stable alkaline phosphatase antibody
    • placental type antibody
    • PLAP antibody
    • PLAP-1 antibody
    • PLAP1 antibody
    • PPB1_HUMAN antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized HeLa (human epithelial cell line from cervix adenocarcinoma) cells labeling Placental alkaline phosphatase (PLAP) using ab243731 at 4 µg/ml (green) in ICC/IF.

  • Anti-Placental alkaline phosphatase (PLAP) antibody (ab243731) at 0.4 µg/ml + Human placenta tissue lysate

    Predicted band size: 58 kDa

  • Formalin-fixed, paraffin-embedded human placenta tissue stained for Placental alkaline phosphatase (PLAP) with ab243731 at a 1/50 dilution in immunohistochemical analysis.

References

ab243731 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243731.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up