Overview

  • Product name

    Anti-Plakophilin 2/PKP2 antibody [8H6]
    See all Plakophilin 2/PKP2 primary antibodies
  • Description

    Mouse monoclonal [8H6] to Plakophilin 2/PKP2
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WB, IP, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human Plakophilin 2/PKP2 aa 1-350.
    Sequence:

    MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQT VKSLRIQEQVQQTLARKGRSSVGNGNLHRTSSVPEYVYNLHLVENDFVGG RSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERSLRHPLRRLEI SPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRYARSEIV GVSRAGTTSRQRHFDTYHRQYQHGSVSDTVFDSIPANPALLTYPRPGTSR SMGNLLEKENYLTAGLTVGQVRPLVPLQPVTQNRASRSSWHQSSFHSTRT LREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADME

  • General notes

     This product was previously labelled as Plakophilin 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab151402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB 1/100. Predicted molecular weight: 97 kDa.
IP Use at an assay dependent concentration.
Flow Cyt Use 1µg for 106 cells.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

Target

  • Function

    May play a role in junctional plaques.
  • Tissue specificity

    Detected in heart right ventricle (at protein level). Widely expressed. Found at desmosomal plaques in simple and stratified epithelia and in non-epithelial tissues such as myocardium and lymph node follicles. In most stratified epithelia found in the desmosomes of the basal cell layer and seems to be absent from suprabasal strata.
  • Involvement in disease

    Familial arrhythmogenic right ventricular dysplasia 9
  • Sequence similarities

    Belongs to the beta-catenin family.
    Contains 8 ARM repeats.
  • Cellular localization

    Nucleus. Cell junction > desmosome. Nuclear and associated with desmosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARVD 9 antibody
    • ARVD9 antibody
    • PKP 2 antibody
    • PKP2 antibody
    • PKP2_HUMAN antibody
    • Plakophilin-2 antibody
    • Plakophilin2 antibody
    see all

Images

  • Overlay histogram showing HeLa cells stained with ab151402 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions followed by the antibody (ab151402, 1μg/1x106 cells) for 30 min at 22°C. The secondary antibody used was Alexa Fluor® 488 goat anti-mouse IgG (H&L) (ab150113) at 1/2000 dilution for 30 min at 22°C. Isotype control antibody (black line) was mouse IgG1 [ICIGG1] (ab91353, 1μg/1x106 cells) used under the same conditions. Unlabelled sample (blue line) was also used as a control. Acquisition of >5,000 events were collected using a 20mW Argon ion laser (488nm) and 525/30 bandpass filter.
  • Anti-Plakophilin 2/PKP2 antibody [8H6] (ab151402) at 1/100 dilution + HaCat Human keratinocyte cells

    Predicted band size: 97 kDa
    Observed band size: 92 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Wang L  et al. Arrhythmogenic cardiomyopathy: Identification of desmosomal gene variations and desmosomal protein expression in variation carriers. Exp Ther Med 15:2255-2262 (2018). Read more (PubMed: 29456632) »
See 1 Publication for this product

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunocytochemistry
Sample
Mouse Cultured Cells (3T3 Fibroblasts)
Specification
3T3 Fibroblasts
Blocking step
BSA as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 21°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Jun 18 2015

Application
Western blot
Sample
Human Tissue lysate - other (Cardiac)
Gel Running Conditions
Reduced Denaturing (10%)
Loading amount
10 µg
Specification
Cardiac
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 22°C

Abcam user community

Verified customer

Submitted Dec 18 2013

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up