Anti-Plakophilin 2/PKP2 antibody (ab220840)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Plakophilin 2/PKP2 antibody
See all Plakophilin 2/PKP2 primary antibodies -
Description
Rabbit polyclonal to Plakophilin 2/PKP2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Plakophilin 2/PKP2 aa 331-416.
Sequence:NLLTERSTFTDSQLGNADMEMTLERAVSMLEADHMLPSRISAAATFIQHE CFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVC
Database link: Q99959 -
Positive control
- Caco2 cells
-
General notes
This product was previously labelled as Plakophilin 2
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220840 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
|
| IHC-P | 1/200. |
Target
-
Function
May play a role in junctional plaques. -
Tissue specificity
Detected in heart right ventricle (at protein level). Widely expressed. Found at desmosomal plaques in simple and stratified epithelia and in non-epithelial tissues such as myocardium and lymph node follicles. In most stratified epithelia found in the desmosomes of the basal cell layer and seems to be absent from suprabasal strata. -
Involvement in disease
Familial arrhythmogenic right ventricular dysplasia 9 -
Sequence similarities
Belongs to the beta-catenin family.
Contains 8 ARM repeats. -
Cellular localization
Nucleus. Cell junction > desmosome. Nuclear and associated with desmosomes. - Information by UniProt
-
Database links
- Entrez Gene: 5318 Human
- Omim: 602861 Human
- SwissProt: Q99959 Human
- Unigene: 164384 Human
-
Alternative names
- ARVD 9 antibody
- ARVD9 antibody
- PKP 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)Immunohistochemical anlysis of paraffin-embedded human heart tissue staining PKP2 with ab220840 at 1/200 dilution.
-
Immunocytochemistry/ Immunofluorescence - Anti-Plakophilin 2/PKP2 antibody (ab220840)Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized Caco2 cells labeling Plakophilin 2/PKP2 using ab220840 at 4 μg/ml (green).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)Immunohistochemical anlysis of paraffin-embedded human kidney tissue staining PKP2 with ab220840 at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)Immunohistochemical anlysis of paraffin-embedded human testis tissue staining PKP2 with ab220840 at 1/200 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)Immunohistochemical anlysis of paraffin-embedded human liver tissue staining PKP2 with ab220840 at 1/200 dilution.
Datasheets and documents
References
ab220840 has not yet been referenced specifically in any publications.
