Anti-Plakophilin 2/PKP2 antibody (ab220840)
Key features and details
- Rabbit polyclonal to Plakophilin 2/PKP2
- Suitable for: ICC/IF, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Plakophilin 2/PKP2 antibody
See all Plakophilin 2/PKP2 primary antibodies -
Description
Rabbit polyclonal to Plakophilin 2/PKP2 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Plakophilin 2/PKP2 aa 331-416.
Sequence:NLLTERSTFTDSQLGNADMEMTLERAVSMLEADHMLPSRISAAATFIQHE CFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVC
Database link: Q99959 -
Positive control
- ICC: Caco-2 cells. IHC-P: Human heart, testis, liver and prostate tissues.
-
General notes
This product was previously labelled as Plakophilin 2
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.2
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220840 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
IHC-P | 1/200 - 1/500. |
Target
-
Function
May play a role in junctional plaques. -
Tissue specificity
Detected in heart right ventricle (at protein level). Widely expressed. Found at desmosomal plaques in simple and stratified epithelia and in non-epithelial tissues such as myocardium and lymph node follicles. In most stratified epithelia found in the desmosomes of the basal cell layer and seems to be absent from suprabasal strata. -
Involvement in disease
Familial arrhythmogenic right ventricular dysplasia 9 -
Sequence similarities
Belongs to the beta-catenin family.
Contains 8 ARM repeats. -
Cellular localization
Nucleus. Cell junction > desmosome. Nuclear and associated with desmosomes. - Information by UniProt
-
Database links
- Entrez Gene: 5318 Human
- Omim: 602861 Human
- SwissProt: Q99959 Human
- Unigene: 164384 Human
-
Alternative names
- ARVD 9 antibody
- ARVD9 antibody
- PKP 2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)
Immunohistochemical anlysis of paraffin-embedded human heart tissue staining Plakophilin 2/PKP2 with ab220840 at 1/500 dilution.
-
Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized Caco2 cells labeling Plakophilin 2/PKP2 using ab220840 at 4 μg/ml (green).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)
Immunohistochemical anlysis of paraffin-embedded human testis tissue staining Plakophilin 2/PKP2 with ab220840 at 1/500 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)
Immunohistochemical anlysis of paraffin-embedded human liver tissue staining Plakophilin 2/PKP2 with ab220840 at 1/500 dilution.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Plakophilin 2/PKP2 antibody (ab220840)
Immunohistochemical anlysis of paraffin-embedded human prostate tissue staining Plakophilin 2/PKP2 with ab220840 at 1/500 dilution.
Protocols
Datasheets and documents
References (0)
ab220840 has not yet been referenced specifically in any publications.