Overview

  • Product name

    Anti-Plakophilin 2/PKP2 antibody
    See all Plakophilin 2/PKP2 primary antibodies
  • Description

    Rabbit polyclonal to Plakophilin 2/PKP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Plakophilin 2/PKP2 aa 72-194.
    Sequence:

    VGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEG RWGRGTAQYSSQKSVEERSLRHPLRRLEISPDSSPERAHYTHSDYQYSQR SQAGHTLHHQESRRAALLVPPRY


    Database link: Q99959

  • Positive control

    • WB: Caco-2 cell lysate. IHC-P: Human heart muscle tissue. ICC/IF: A431 cells.
  • General notes

     This product was previously labelled as Plakophilin 2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab223757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 97.4 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/permeabilization: PFA/Triton X-100

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    May play a role in junctional plaques.
  • Tissue specificity

    Detected in heart right ventricle (at protein level). Widely expressed. Found at desmosomal plaques in simple and stratified epithelia and in non-epithelial tissues such as myocardium and lymph node follicles. In most stratified epithelia found in the desmosomes of the basal cell layer and seems to be absent from suprabasal strata.
  • Involvement in disease

    Familial arrhythmogenic right ventricular dysplasia 9
  • Sequence similarities

    Belongs to the beta-catenin family.
    Contains 8 ARM repeats.
  • Cellular localization

    Nucleus. Cell junction > desmosome. Nuclear and associated with desmosomes.
  • Information by UniProt
  • Database links

  • Alternative names

    • ARVD 9 antibody
    • ARVD9 antibody
    • PKP 2 antibody
    • PKP2 antibody
    • PKP2_HUMAN antibody
    • Plakophilin-2 antibody
    • Plakophilin2 antibody
    see all

Images

  • Anti-Plakophilin 2/PKP2 antibody (ab223757) at 1/100 dilution + Caco-2 (human colorectal adenocarcinoma cell line) cell lysate

    Predicted band size: 97.4 kDa

  • Immunohistochemical analyssi of paraffin embedded human heart muscle tissue staining PKP2 with ab223757 at 1/50 dilution.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for Plakophilin 2/PKP2 (green) using ab223757 at 4 µg/ml in ICC/IF.

  • Immunohistochemical analyssi of paraffin embedded human skeletal muscle tissue staining PKP2 with ab223757 at 1/50 dilution.

  • Immunohistochemical analyssi of paraffin embedded human liver tissue staining PKP2 with ab223757 at 1/50 dilution.

  • Immunohistochemical analyssi of paraffin embedded human testis tissue staining PKP2 with ab223757 at 1/50 dilution.

  • Paraffin embedded sections of human heart muscle tissue stained for Plakophilin 2/PKP2 with ab223757 at 1/50 dilution in immunohistochemical analysis.

References

ab223757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up