Overview

  • Product name

  • Description

    Rabbit polyclonal to Plastin L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human Plastin L aa 2-627.
    Sequence:

    ARGSVSDEEMMELREAFAKVDTDGNGYISFNELNDLFKAACLPLPGYRVR EITENLMATGDLDQDGRISFDEFIKIFHGLKSTDVAKTFRKAINKKEGIC AIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTN DLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNSA SAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIAL LREGESLEDLMKLSPEELLLRWANYHLENAGCNKIGNFSTDIKDSKAYYH LLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVT ATDVVRGNPKLNLAFIANLFNRYPALHKPENQDIDWGALEGETREERTFR NWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLG GNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRR YTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLP VLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALP EDLVEVNPKMVMTVFACLMGKGMKRV


    Database link: P13796-1

  • Positive control

    • WB: HL-60, THP-1, K562, Jurkat, HeLa and NIH/3T3 whole cell lysates. IHC-P: Human spleen tissue. IP: Jurkat whole cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab236104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 70 kDa.
IP 1/200 - 1/2000.
IHC-P 1/200 - 1/500.

Target

  • Function

    Actin-binding protein. Plays a role in the activation of T-cells in response to costimulation through TCR/CD3 and CD2 or CD28. Modulates the cell surface expression of IL2RA/CD25 and CD69.
  • Tissue specificity

    Detected in intestinal microvilli, hair cell stereocilia, and fibroblast filopodia, in spleen and other lymph node-containing organs. Expressed in peripheral blood T lymphocytes, neutrophils, monocytes, B lymphocytes, and myeloid cells.
  • Sequence similarities

    Contains 2 actin-binding domains.
    Contains 4 CH (calponin-homology) domains.
    Contains 2 EF-hand domains.
  • Post-translational
    modifications

    Phosphorylated on a serine residue in response to costimulation through TCR/CD3 and CD2 or CD28. Serine phosphorylation promotes association with the actin cytoskeleton and targeting to peripheral cell projections.
    The N-terminus is blocked.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell junction. Cell projection. Cell projection > ruffle membrane. Relocalizes to the immunological synapse between peripheral blood T lymphocytes and antibody-presenting cells in response to costimulation through TCR/CD3 and CD2 or CD28. Associated with the actin cytoskeleton at membrane ruffles (By similarity). Relocalizes to actin-rich cell projections upon serine phosphorylation.
  • Information by UniProt
  • Database links

  • Alternative names

    • CP64 antibody
    • L plastin antibody
    • L-plastin antibody
    • Larval cuticle protein 1 antibody
    • LC64P antibody
    • LCP-1 antibody
    • LCP1 antibody
    • LPL antibody
    • Lplastin antibody
    • Lymphocyte cytosolic protein 1 antibody
    • Plastin 2 antibody
    • Plastin-2 antibody
    • PLS2 antibody
    • PLSL_HUMAN antibody
    see all

Images

  • All lanes : Anti-Plastin L antibody (ab236104) at 1/1000 dilution

    Lane 1 : HL-60 (human promyelocytic leukemia cell line) whole cell lysate
    Lane 2 : THP-1 (human monocytic leukemia cell line) whole cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 4 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 5 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 6 : NIH/3T3 (mouse embryo fibroblast cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 70 kDa

  • Paraffin-embedded human spleen tissue stained for Plastin L using ab236104 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Plastin L was immunoprecipitated from Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate using ab236104 at 1/200 dilution.

    Lane 1: Rabbit control IgG in Jurkat whole cell lysate.

    Lane 2: ab236104 in Jurkat whole cell lysate.

    Lane 3: Jurkat whole cell lysate (20 µg input).

    For western blotting an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab236104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up