Overview

  • Product name

  • Description

    Rabbit polyclonal to PLCD4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Full length protein corresponding to Human PLCD4 aa 1-762. (NP_116115.1)
    Sequence:

    MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHA RQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRS NLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQ DGKMSFQEVQRLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYK ALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDCTSELALELID RYEPSDSGKLRHVLSMDGFLSYLCSKDGDIFNPACLPIYQDMTQPLNHYF ICSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDVWDGPSGEPVVYH GHTLTSRILFKDVVATVAQYAFQTSDYPVILSLETHCSWEQQQTMARHLT EILGEQLLSTTLDGVLPTQLPSPEELRRKILVKGKKLTLEEDLEYEEEEA EPELEESELALESQFETEPEPQEQNLQNKDKKKKSKPILCPALSSLVIYL KSVSFRSFTHSKEHYHFYEISSFSETKAKRLIKEAGNEFVQHNTWQLSRV YPSGLRTDSSNYNPQELWNAGCQMVAMNMQTAGLEMDICDGHFRQNGGCG YVLKPDFLRDIQSSFHPEKPISPFKAQTLLIQVISGQQLPKVDKTKEGSI VDPLVKVQIFGVRLDTARQETNYVENNGFNPYWGQTLCFRVLVPELAMLR FVVMDYDWKSRNDFIGQYTLPWTCMQQGYRHIHLLSKDGISLRPASIFVY ICIQEGLEGDES


    Database link: Q9BRC7

  • Positive control

    • PLCD4-transfected 293T cell lysate; Human kidney lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab172897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 88 kDa.

Target

  • Function

    Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca(2+) from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca(2+) mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation.
  • Tissue specificity

    Highly expressed in skeletal muscle and kidney tissues, and at moderate level in intestinal tissue. Expressed in corneal epithelial cells.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 3 EF-hand domains.
    Contains 1 PH domain.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
  • Domain

    The PDZ-binding motif mediates the interaction with GRIP1.
    The C2 domain mediates pre-localization to the membrane prior to Ca(2+) import and non-selective Ca(2+)-mediated targeting to various cellular membranes.
    The PH domain is not a critical determinant of the membrane localization.
  • Cellular localization

    Membrane. Nucleus. Cytoplasm. Endoplasmic reticulum. Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase delta 4 antibody
    • 1-phosphatidylinositol 4 antibody
    • 1-phosphatidylinositol-4 antibody
    • 5-bisphosphate phosphodiesterase delta-4 antibody
    • hPLCD4 antibody
    • MGC12837 antibody
    • Phosphoinositide phospholipase C delta 4 antibody
    • Phosphoinositide phospholipase C-delta-4 antibody
    • Phospholipase C delta 4 antibody
    • Phospholipase C-delta-4 antibody
    • PLC delta 4 antibody
    • PLC delta4 antibody
    • PLC-delta-4 antibody
    • PLCD4 antibody
    • PLCD4_HUMAN antibody
    see all

Images

  • Anti-PLCD4 antibody (ab172897) at 1 µg/ml + Human kidney lysate at 50 µg

    Secondary
    Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 88 kDa

  • All lanes : Anti-PLCD4 antibody (ab172897) at 1 µg/ml

    Lane 1 : PLCD4-transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Rabbit IgG (H+L), Peroxidase Conjugated at 1/7500 dilution

    Developed using the ECL technique.

    Predicted band size: 88 kDa

References

ab172897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up