Overview

  • Product name

  • Description

    Rabbit polyclonal to PLCD4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human PLCD4 aa 90-164.
    Sequence:

    GFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWL SDWFQRGDKNQDGKMSFQEVQRLLH


    Database link: Q9BRC7-1

  • Positive control

    • Human testis tissue and HeLa cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab204316 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function

    Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca(2+) from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca(2+) mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation.
  • Tissue specificity

    Highly expressed in skeletal muscle and kidney tissues, and at moderate level in intestinal tissue. Expressed in corneal epithelial cells.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 3 EF-hand domains.
    Contains 1 PH domain.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
  • Domain

    The PDZ-binding motif mediates the interaction with GRIP1.
    The C2 domain mediates pre-localization to the membrane prior to Ca(2+) import and non-selective Ca(2+)-mediated targeting to various cellular membranes.
    The PH domain is not a critical determinant of the membrane localization.
  • Cellular localization

    Membrane. Nucleus. Cytoplasm. Endoplasmic reticulum. Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase delta 4 antibody
    • 1-phosphatidylinositol 4 antibody
    • 1-phosphatidylinositol-4 antibody
    • 5-bisphosphate phosphodiesterase delta-4 antibody
    • hPLCD4 antibody
    • MGC12837 antibody
    • Phosphoinositide phospholipase C delta 4 antibody
    • Phosphoinositide phospholipase C-delta-4 antibody
    • Phospholipase C delta 4 antibody
    • Phospholipase C-delta-4 antibody
    • PLC delta 4 antibody
    • PLC delta4 antibody
    • PLC-delta-4 antibody
    • PLCD4 antibody
    • PLCD4_HUMAN antibody
    see all

Images

  • Immunofluorescence analysis of paraformaldehyde-fixed HeLa cells labeling PLCD4 using ab204316 at 4 µg/ml.

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue, labeling PLCD4 using ab204316 at a 1/1000 dilution.

References

ab204316 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204316.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up