Overview

  • Product name

  • Description

    Rabbit polyclonal to PLCD4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PLCD4 aa 1-250. Two N-terminal tags. (Expressed in E.coli).
    Sequence:

    MASLLQDQLTTDQDLLLMQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHA RQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRS NLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQ DGKMSFQEVQRLLHLMNVEMDQEYAFSLFQAADTSQSGTLEGEEFVQFYK ALTKRAEVQELFESFSADGQKLTLLEFLDFLQEEQKERDCTSELALELID


    Database link: Q9BRC7

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human PLCD4 protein; Mouse skeletal muscle lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232981 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 88 kDa.

Target

  • Function

    Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca(2+) from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca(2+) mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the Erk signaling pathway and proliferation.
  • Tissue specificity

    Highly expressed in skeletal muscle and kidney tissues, and at moderate level in intestinal tissue. Expressed in corneal epithelial cells.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 3 EF-hand domains.
    Contains 1 PH domain.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
  • Domain

    The PDZ-binding motif mediates the interaction with GRIP1.
    The C2 domain mediates pre-localization to the membrane prior to Ca(2+) import and non-selective Ca(2+)-mediated targeting to various cellular membranes.
    The PH domain is not a critical determinant of the membrane localization.
  • Cellular localization

    Membrane. Nucleus. Cytoplasm. Endoplasmic reticulum. Localizes primarily to intracellular membranes mostly to the endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1 phosphatidylinositol 4 5 bisphosphate phosphodiesterase delta 4 antibody
    • 1-phosphatidylinositol 4 antibody
    • 1-phosphatidylinositol-4 antibody
    • 5-bisphosphate phosphodiesterase delta-4 antibody
    • hPLCD4 antibody
    • MGC12837 antibody
    • Phosphoinositide phospholipase C delta 4 antibody
    • Phosphoinositide phospholipase C-delta-4 antibody
    • Phospholipase C delta 4 antibody
    • Phospholipase C-delta-4 antibody
    • PLC delta 4 antibody
    • PLC delta4 antibody
    • PLC-delta-4 antibody
    • PLCD4 antibody
    • PLCD4_HUMAN antibody
    see all

Images

  • Anti-PLCD4 antibody (ab232981) at 2 µg/ml + Mouse skeletal muscle tissue lysate.

    Predicted band size: 88 kDa

  • Anti-PLCD4 antibody (ab232981) at 2 µg + Recombinant human PLCD4 protein.

    Predicted band size: 88 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PLCD4 using ab232981 at 20µg/mL in imunohistochemical analysis. DAB staining.

References

ab232981 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232981.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up