Overview

  • Product name

    Anti-PLCH2 antibody
  • Description

    Rabbit polyclonal to PLCH2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human PLCH2 aa 1-257. (Expressed in E.coli).
    Sequence:

    MSGPWPSPDSRTKGTVAWLAEVLLWVGGSVVLSSEWQLGPLVERCMGAMQ EGMQMVKLRGGSKGLVRFYYLDEHRSCIRWRPSRKNEKAKISIDSIQEVS EGRQSEVFQRYPDGSFDPNCCFSIYHGSHRESLDLVSTSSEVARTWVTGL RYLMAGISDEDSLARRQRTRDQWLKQTFDEADKNGDGSLSIGEVLQLLHK LNVNLPRQRVKQMFREADTDDHQGTLGFEEFCAFYKMMSTRRDLYLLMLT YSNHKDH


    Database link: O75038

  • Positive control

    • IHC-P: Human kidney tissue. WB: Mouse kidney lysate; Recombinant human PLCH2 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231286 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 155 kDa.

Target

  • Function

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This phospholipase activity is very sensitive to calcium. May be important for formation and maintenance of the neuronal network in the postnatal brain.
  • Tissue specificity

    Expressed in retina and kidney.
  • Sequence similarities

    Contains 1 C2 domain.
    Contains 2 EF-hand domains.
    Contains 1 PH domain.
    Contains 1 PI-PLC X-box domain.
    Contains 1 PI-PLC Y-box domain.
  • Cellular localization

    Cytoplasm. Cell membrane. Localized predominantly at the plasma membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1-phosphatidylinositol-4 antibody
    • 5-bisphosphate phosphodiesterase eta-2 antibody
    • KIAA0450 antibody
    • Phosphoinositide phospholipase C-eta-2 antibody
    • Phosphoinositide phospholipase C-like 4 antibody
    • Phospholipase C-eta-2 antibody
    • Phospholipase C-like protein 4 antibody
    • PLC-eta2 antibody
    • PLC-L4 antibody
    • Plch2 antibody
    • PLCH2_HUMAN antibody
    • PLCL4 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for PLCH2 using ab231286 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-PLCH2 antibody (ab231286) at 2 µg/ml + Recombinant human PLCH2 protein.

    Predicted band size: 155 kDa

  • Anti-PLCH2 antibody (ab231286) at 2 µg/ml + Mouse kidney lysate.

    Predicted band size: 155 kDa

References

ab231286 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231286.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up