Overview

  • Product name

  • Description

    Rabbit polyclonal to PLCXD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human PLCXD1 aa 1-323.
    Sequence:

    MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTY CLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGV RYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWLERHPREVVI LACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIV SYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVA GINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIA GDFIGADGFVSDVIALNQKLLWC


    Database link: Q9NUJ7

  • Positive control

    • WB: Jurkat whole cell lysate. IHC-P: Human placenta tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab235517 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 37 kDa.
IHC-P 1/20 - 1/200.

Target

  • Sequence similarities

    Contains 1 PI-PLC X-box domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ11323 antibody
    • LL0XNC01-136G2.1 antibody
    • Phosphatidylinositol specific phospholipase C X domain containing 1 antibody
    • Phosphatidylinositol specific phospholipase C X domain containing protein 1 antibody
    • PI PLC X domain containing protein 1 antibody
    • PI-PLC X domain-containing protein 1 antibody
    • PLCX1_HUMAN antibody
    • Plcxd1 antibody
    see all

Images

  • Anti-PLCXD1 antibody (ab235517) at 1/1000 dilution + Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate

    Secondary
    Goat polyclonal to rabbit at 1/10000 dilution

    Predicted band size: 37 kDa

  • Paraffin-embedded human placenta tissue stained for PLCXD1 using ab235517 at 1/100 dilution in immunohistochemical analysis.

References

ab235517 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235517.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up